Mouse anti-Human DDB1 Monoclonal Antibody | anti-DDB1 antibody

DDB1 (DNA Damage-binding Protein 1, DDB p127 Subunit, DNA Damage-binding Protein a, DDBa, Damage-specific DNA-binding Protein 1, HBV X-associated Protein 1, XAP-1, UV-damaged DNA-binding Factor, UV-damaged DNA-binding Protein 1, UV-DDB 1, XPE-binding Fact

Cat. Num. AAA6141493

• Gene Names: DDB1; XPE; DDBA; XAP1; XPCE; XPE-BF; UV-DDB1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DDB1; Monoclonal Antibody; DDB1 (DNA Damage-binding Protein 1; DDB p127 Subunit; DNA Damage-binding Protein a; DDBa; Damage-specific DNA-binding Protein 1; HBV X-associated Protein 1; XAP-1; UV-damaged DNA-binding Factor; UV-damaged DNA-binding Protein 1; UV-DDB 1; XPE-binding Fact; anti-DDB1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4C5
• Specificity: Recognizes human DDB1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-DDB1 antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Sandwich ELISA (Recombinant protein): The detection limit is ~0.3ng/ml as a capture antibody.; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1044-1140 from human DDB1 (NP_001914) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.41kD))

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to DDB1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged DDB1 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-DDB1 antibody

Antibodies; DNA Repair/Damage

NCBI and Uniprot Product Information

• NCBI GI #: 148529014
• NCBI GeneID: 1642
• NCBI Accession #: NP_001914
• NCBI GenBank Nucleotide #: NM_001923
• UniProt Accession #: Q16531; O15176; Q13289; Q58F96; A6NG77; B2R648; B4DG00
• Molecular Weight: 50,611 Da
• NCBI Official Full Name: DNA damage-binding protein 1
• NCBI Official Synonym Full Names: damage-specific DNA binding protein 1, 127kDa
• NCBI Official Symbol: DDB1
• NCBI Official Synonym Symbols: XPE; DDBA; XAP1; XPCE; XPE-BF; UV-DDB1
• NCBI Protein Information: DNA damage-binding protein 1; DDB p127 subunit; DNA damage-binding protein a; HBV X-associated protein 1; UV-DDB 1; UV-damaged DNA-binding factor; UV-damaged DNA-binding protein 1; XAP-1; XPE-binding factor; xeroderma pigmentosum group E-complementing pro
• UniProt Protein Name: DNA damage-binding protein 1
• Protein Family: DNA damage-binding protein
• UniProt Gene Name: DDB1
• UniProt Synonym Gene Names: XAP1; DDBa; XAP-1; UV-DDB 1; XPE-BF; XPCe
• UniProt Entry Name: DDB1_HUMAN

Uniprot Description

DDB1: the large subunit of theUV- damaged DNA-binding protein complex (the UV-DDB complex) required for DNA repair. The UV- DDB complex may recognize UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair. The UV-DDB complex preferentially binds to cyclobutane pyrimidine dimers (CPD), 6-4 photoproducts (6-4 PP), apurinic sites and short mismatches. Also appears to function as a component of numerous distinct DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. The functional specificity of the DCX E3 ubiquitin- protein ligase complex is determined by the variable substrate recognition component recruited by DDB1. DCX(DDB2) (also known as DDB1-CUL4-ROC1, CUL4-DDB-ROC1 and CUL4-DDB-RBX1) may ubiquitinate histone H2A, histone H3 and histone H4 at sites of UV-induced DNA damage. The ubiquitination of histones may facilitate their removal from the nucleosome and promote subsequent DNA repair. DCX(DDB2) also ubiquitinates XPC, which may enhance DNA-binding by XPC and promote NER. DCX(DTL) plays a role in PCNA-dependent polyubiquitination of CDT1 and MDM2-dependent ubiquitination of p53 in response to radiation-induced DNA damage and during DNA replication. DCX(ERCC8) (the CSA complex) plays a role in transcription-coupled repair (TCR). May also play a role in ubiquitination of p27kip when associated with CUL4 and SKP2. Component of the UV-DDB complex which includes DDB1 and DDB2. The UV-DDB complex interacts with monoubiquitinated histone H2A and binds to XPC via the DDB2 subunit. Component of numerous DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complexes which consist of a core of DDB1, CUL4A or CUL4B and RBX1. DDB1 may recruit specific substrate targeting subunits to the DCX complex. These substrate targeting subunits are generally known as DCAF (DDB1- and CUL4-associated factor) or CDW (CUL4-DDB1-associated WD40-repeat) proteins. Interacts with AMBRA1, ATG16L1, BTRC, DCAF1, DCAF17, DCAF16, DCAF15, DDA1, DET1, DTL, ERCC8, FBXW5, FBXW8, GRWD1, DCAF6, KATNB1, NLE1, NUP43, PAFAH1B1, PHIP, PWP1, RBBP4, RBBP5, RBBP7, RFWD2, SNRNP40, VPRBP, WDR5, WDR5B, WDR12, DCAF4, DCAF5, DCAF11, WDR26, DCAF10, WDR39, DCAF12, WDR42, DCAF8, WDR53, WDR59, WDR61, DCAF7, WSB1, WSB2 and WDTC1. DCX complexes may associate with the COP9 signalosome, and this inhibits the E3 ubiquitin-protein ligase activity of the complex. Interacts with NF2, TSC1 and TSC2. Interacts with Simian virus 5 protein V and the HBV X protein. Interaction with SV5 protein V may prevent the recruitment of DCAF proteins to DCX complexes. Interacts with EIF2C1 and EIF2C2. Associates with the E3 ligase complex containing DYRK2, UBR5, DDB1 and VPRBP proteins (EDVP complex). Interacts directly with DYRK2. Belongs to the DDB1 family.

Protein type: DNA repair, damage

Chromosomal Location of Human Ortholog: 11q12-q13

Cellular Component: nucleoplasm; extracellular space; cytoplasm; nucleus

Molecular Function: protein binding; DNA binding; damaged DNA binding

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; positive regulation of viral genome replication; Wnt receptor signaling pathway; viral reproduction; nucleotide-excision repair; protein ubiquitination during ubiquitin-dependent protein catabolic process; nucleotide-excision repair, DNA damage removal; positive regulation of viral protein levels in host cell; interaction with symbiont; DNA repair; negative regulation of apoptosis