Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (57.46kD).)

Mouse anti-Human DDAH2 Monoclonal Antibody | anti-DDAH2 antibody

DDAH2 (Dimethylarginine Dimethylaminohydrolase II, NG30, G6a, OTTHUMP00000174406, OTTHUMP00000029307, DADB-110M10.5, OTTHUMP00000062666, NG-dimethylarginine Dimethylamino Hydrolase Homolog, Dimethylarginine Dimethylaminohydrolase II, DDAHII, NG30, G6a, DD

Gene Names
DDAH2; G6a; DDAH; NG30; DDAHII; HEL-S-277
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DDAH2; Monoclonal Antibody; DDAH2 (Dimethylarginine Dimethylaminohydrolase II; NG30; G6a; OTTHUMP00000174406; OTTHUMP00000029307; DADB-110M10.5; OTTHUMP00000062666; NG-dimethylarginine Dimethylamino Hydrolase Homolog; Dimethylarginine Dimethylaminohydrolase II; DDAHII; DD; anti-DDAH2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3E3
Specificity
Recognizes human DDAH2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DDAH2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-286 from DDAH2 (AAH01435) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLRLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEIGDENATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGLCGMGGPRTVVAGSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGGDLPNSQEALQKLSDV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (57.46kD).)

Western Blot (WB) (Western Blot detection against Immunogen (57.46kD).)

Testing Data

(Detection limit for recombinant GST tagged DDAH2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DDAH2 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-DDAH2 antibody
DDAH2 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. Overexpression of DDAH2 has also been linked to increased VEGF mRNA expression and enhanced tube formation by cells grown in a 3-dimensional medium.
Product Categories/Family for anti-DDAH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
29,644 Da
NCBI Official Full Name
Homo sapiens dimethylarginine dimethylaminohydrolase 2, mRNA
NCBI Official Synonym Full Names
dimethylarginine dimethylaminohydrolase 2
NCBI Official Symbol
DDAH2
NCBI Official Synonym Symbols
G6a; DDAH; NG30; DDAHII; HEL-S-277
NCBI Protein Information
N(G),N(G)-dimethylarginine dimethylaminohydrolase 2

NCBI Description

This gene encodes a dimethylarginine dimethylaminohydrolase. The encoded enzyme functions in nitric oxide generation by regulating the cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. The protein may be localized to the mitochondria. Alternative splicing resulting in multiple transcript variants. [provided by RefSeq, Dec 2014]

Research Articles on DDAH2

Similar Products

Product Notes

The DDAH2 (Catalog #AAA6130886) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DDAH2 (Dimethylarginine Dimethylaminohydrolase II, NG30, G6a, OTTHUMP00000174406, OTTHUMP00000029307, DADB-110M10.5, OTTHUMP00000062666, NG-dimethylarginine Dimethylamino Hydrolase Homolog, Dimethylarginine Dimethylaminohydrolase II, DDAHII, NG30, G6a, DD reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDAH2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DDAH2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDAH2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.