Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DCP1A monoclonal antibody (M01), clone 2D12. Western Blot analysis of DCP1A expression in IMR-32 (Cat # L008V1).)

Mouse DCP1A Monoclonal Antibody | anti-DCP1A antibody

DCP1A (DCP1 decapping Enzyme Homolog A (S. cerevisiae), FLJ21691, HSA275986, Nbla00360, SMAD4IP1, SMIF) (Biotin)

Gene Names
DCP1A; SMIF; SMAD4IP1; HSA275986; Nbla00360
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
DCP1A; Monoclonal Antibody; DCP1A (DCP1 decapping Enzyme Homolog A (S. cerevisiae); FLJ21691; HSA275986; Nbla00360; SMAD4IP1; SMIF) (Biotin); DCP1 decapping Enzyme Homolog A (S. cerevisiae); SMIF; anti-DCP1A antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D12
Specificity
Recognizes DCP1A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-DCP1A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DCP1A (NP_060873, 186aa-285aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(DCP1A monoclonal antibody (M01), clone 2D12. Western Blot analysis of DCP1A expression in IMR-32 (Cat # L008V1).)

Western Blot (WB) (DCP1A monoclonal antibody (M01), clone 2D12. Western Blot analysis of DCP1A expression in IMR-32 (Cat # L008V1).)

Western Blot (WB)

(Western Blot analysis of DCP1A expression in transfected 293T cell line by DCP1A monoclonal antibody (M01), clone 2D12.Lane 1: DCP1A transfected lysate (63.3 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DCP1A expression in transfected 293T cell line by DCP1A monoclonal antibody (M01), clone 2D12.Lane 1: DCP1A transfected lysate (63.3 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-DCP1A antibody
Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. [provided by RefSeq]
Product Categories/Family for anti-DCP1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
mRNA-decapping enzyme 1A isoform a
NCBI Official Synonym Full Names
decapping mRNA 1A
NCBI Official Symbol
DCP1A
NCBI Official Synonym Symbols
SMIF; SMAD4IP1; HSA275986; Nbla00360
NCBI Protein Information
mRNA-decapping enzyme 1A
UniProt Protein Name
mRNA-decapping enzyme 1A
Protein Family
UniProt Gene Name
DCP1A
UniProt Synonym Gene Names
SMIF
UniProt Entry Name
DCP1A_HUMAN

NCBI Description

Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Uniprot Description

DCP1A: a decapping enzyme. Plays a role in general and regulated mRNA decay. Apparently plays a role in the nonsense-mediated decay pathway that rids cells of mRNAs containing premature termination codons. May function as a transactivator of SMAD4 that participates in TGF-beta signaling.

Protein type: RNA processing; Transcription, coactivator/corepressor; EC 3.-.-.-; Hydrolase

Chromosomal Location of Human Ortholog: 3p21.1

Cellular Component: membrane; cytosol; nucleus

Molecular Function: identical protein binding; protein binding; hydrolase activity

Biological Process: mRNA catabolic process, nonsense-mediated decay; gene expression; mRNA catabolic process, deadenylation-dependent decay

Research Articles on DCP1A

Similar Products

Product Notes

The DCP1A dcp1a (Catalog #AAA6172650) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DCP1A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DCP1A dcp1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DCP1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.