Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection using MBS6002248 against Immunogen (35.9kD).)

Mouse anti-Human, Mouse DCAMKL1 Monoclonal Antibody

DCAMKL1 (DCLK1, DCDC3A, KIAA0369, Serine/Threonine-protein Kinase DCLK1, Doublecortin Domain-containing Protein 3A, Doublecortin-like and CAM Kinase-like 1, Doublecortin-like Kinase 1)

Reactivity
Human, Mouse
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DCAMKL1; Monoclonal Antibody; DCAMKL1 (DCLK1; DCDC3A; KIAA0369; Serine/Threonine-protein Kinase DCLK1; Doublecortin Domain-containing Protein 3A; Doublecortin-like and CAM Kinase-like 1; Doublecortin-like Kinase 1); Anti -DCAMKL1 (DCLK1; anti-DCAMKL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
6F9
Specificity
Recognizes human DCAMKL1. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM
Applicable Applications for anti-DCAMKL1 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in ELISA, Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa640-729 from DCAMKL1 (NP_004725) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection using MBS6002248 against Immunogen (35.9kD).)

Western Blot (WB) (Western Blot detection using MBS6002248 against Immunogen (35.9kD).)

Western Blot (WB)

(Western Blot analysis of DCAMKL1 expression in NIH/3T3 using MBS6002248.)

Western Blot (WB) (Western Blot analysis of DCAMKL1 expression in NIH/3T3 using MBS6002248.)

Immunofluorescence (IF)

(Immunofluorescence of DCAMKL1 on NIH/3T3 cell using MBS6002248 (10ug/ml).)

Immunofluorescence (IF) (Immunofluorescence of DCAMKL1 on NIH/3T3 cell using MBS6002248 (10ug/ml).)
Related Product Information for anti-DCAMKL1 antibody
Doublecortin-like kinase (DCAMKL1)(Ser/Thr protein kinase family) is essential for proper neurogenesis, neuronal migration, and axonal wiring. DCAMKL1 is involved in a calcium-signaling pathway controling neuronal migration in the developing brain, and participates in functions of the mature nervous system. DCAMKL1 protein shares high homology with doublecortin (DCX). DCLK, but not DCX, is highly expressed in regions of active neurogenesis in the neocortex and cerebellum. DCAMKL1 controls mitotic division by regulating spindle formation and also determines the fate of neural progenitors during cortical neurogenesis.
Product Categories/Family for anti-DCAMKL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
Dcamkl1

Similar Products

Product Notes

The DCAMKL1 (Catalog #AAA6002248) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DCAMKL1 (DCLK1, DCDC3A, KIAA0369, Serine/Threonine-protein Kinase DCLK1, Doublecortin Domain-containing Protein 3A, Doublecortin-like and CAM Kinase-like 1, Doublecortin-like Kinase 1) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DCAMKL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in ELISA, Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the DCAMKL1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QVLEHPWVND DGLPENEHQL SVAGKIKKHF NTGPKPNSTA AGVSVIALDH GFTIKRSGSL DYYQQPGMYW IRPPLLIRRG RFSDEDATRM. It is sometimes possible for the material contained within the vial of "DCAMKL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.