Mouse DCAMKL1 Monoclonal Antibody | anti-DCAMKL1 antibody

DCAMKL1 (Doublecortin-like Kinase 1, DCAMKL1, DCDC3A, DCLK, KIAA0369) (PE)

Cat. Num. AAA6183869

• Gene Names: DCLK1; CL1; DCLK; CLICK1; DCDC3A; DCAMKL1
• Applications: Western Blot
• Purity: Purified
• Synonyms: DCAMKL1; Monoclonal Antibody; DCAMKL1 (Doublecortin-like Kinase 1; DCDC3A; DCLK; KIAA0369) (PE); Doublecortin-like Kinase 1; KIAA0369; anti-DCAMKL1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 7D10
• Specificity: Recognizes DCAMKL1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-DCAMKL1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: DCAMKL1 (NP_004725, 640aa-729aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(DCAMKL1 monoclonal antibody (M01), clone 7D10. Western Blot analysis of DCLK1 expression in rat brain.)

Testing Data

(Detection limit for recombinant GST tagged DCLK1 is 0.03 ng/ml as a capture antibody.)

Related Product Information for anti-DCAMKL1 antibody

DCAMKL1 is a microtubule-associated protein that phosphorylates itself and myelin basic protein (MBP; MIM 159430). DCAMKL1 has microtubule polymerizing activity that is independent of its protein kinase activity (Lin et al., 2000 [PubMed 11124993]). [supplied by OMIM]

Product Categories/Family for anti-DCAMKL1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4758128
• NCBI GeneID: 9201
• NCBI Accession #: NP_004725
• NCBI GenBank Nucleotide #: NM_004734.4
• UniProt Accession #: O15075; Q5VZY8; Q5VZZ0; Q5VZZ1; B7Z3E9
• Molecular Weight: 47,681 Da
• NCBI Official Full Name: serine/threonine-protein kinase DCLK1 isoform 1
• NCBI Official Synonym Full Names: doublecortin-like kinase 1
• NCBI Official Symbol: DCLK1
• NCBI Official Synonym Symbols: CL1; DCLK; CLICK1; DCDC3A; DCAMKL1
• NCBI Protein Information: serine/threonine-protein kinase DCLK1; doublecortin-like and CAM kinase-like 1; doublecortin domain-containing protein 3A
• UniProt Protein Name: Serine/threonine-protein kinase DCLK1
• UniProt Gene Name: DCLK1
• UniProt Synonym Gene Names: DCAMKL1; DCDC3A; KIAA0369
• UniProt Entry Name: DCLK1_HUMAN

NCBI Description

This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmodulin-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions. The microtubule-polymerizing activity of the encoded protein is independent of its protein kinase activity. The encoded protein is involved in several different cellular processes, including neuronal migration, retrograde transport, neuronal apoptosis and neurogenesis. This gene is up-regulated by brain-derived neurotrophic factor and associated with memory and general cognitive abilities. Multiple transcript variants generated by two alternative promoter usage and alternative splicing have been reported, but the full-length nature and biological validity of some variants have not been defined. These variants encode different isoforms, which are differentially expressed and have different kinase activities.[provided by RefSeq, Sep 2010]

Uniprot Description

DCAMKL1: a serine-threonine kinase of the CAMK family. May be involved in a calcium-signaling pathway controling neuronal migration in the developing brain. May also participate in functions of the mature nervous system. Genetic and physical interactions with Doublecortin, which causes lissencephaly. A putative marker of quiescent stem cells. Four alternatively spliced isoforms have been described.

Protein type: Kinase, protein; Nuclear receptor co-regulator; Protein kinase, CAMK; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); CAMK group; DCAMKL family

Chromosomal Location of Human Ortholog: 13q13

Cellular Component: integral to plasma membrane

Molecular Function: protein serine/threonine kinase activity; receptor signaling protein activity; ATP binding; protein kinase activity

Biological Process: nervous system development; central nervous system development; axon extension; dendrite morphogenesis; response to virus; forebrain development; neuron migration; central nervous system projection neuron axonogenesis; endosome transport; protein amino acid phosphorylation