Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DAB2 Monoclonal Antibody | anti-DAB2 antibody

DAB2 (DOC-2, Differentially-expressed Protein 2, Disabled Homolog 2, DOC2) (MaxLight 650)

Gene Names
DAB2; DOC2; DOC-2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DAB2; Monoclonal Antibody; DAB2 (DOC-2; Differentially-expressed Protein 2; Disabled Homolog 2; DOC2) (MaxLight 650); anti-DAB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C8
Specificity
Recognizes human DAB2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
770
Applicable Applications for anti-DAB2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa673-770 from human DAB2 (NP_001334) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QTSSGTLSAFASYFNSKVGIPQENADHDDFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DAB2 antibody
DAB2 is the component of the CSF-1 signal transduction pathway.
Product Categories/Family for anti-DAB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
disabled homolog 2 isoform 1
NCBI Official Synonym Full Names
DAB adaptor protein 2
NCBI Official Symbol
DAB2
NCBI Official Synonym Symbols
DOC2; DOC-2
NCBI Protein Information
disabled homolog 2
UniProt Protein Name
Disabled homolog 2
Protein Family
UniProt Gene Name
DAB2
UniProt Synonym Gene Names
DOC2
UniProt Entry Name
DAB2_HUMAN

NCBI Description

This gene encodes a mitogen-responsive phosphoprotein. It is expressed in normal ovarian epithelial cells, but is down-regulated or absent from ovarian carcinoma cell lines, suggesting its role as a tumor suppressor. This protein binds to the SH3 domains of GRB2, an adaptor protein that couples tyrosine kinase receptors to SOS (a guanine nucleotide exchange factor for Ras), via its C-terminal proline-rich sequences, and may thus modulate growth factor/Ras pathways by competing with SOS for binding to GRB2. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

DAB2: an adaptor protein that interacts with Grb2, myosin VI, SMAD2/3, DIP1/2, Dvl-3, the integrin betasubunit, and c-Src. Negatively regulates canonical Wnt signaling by stabilizing the beta-catenin degradation complex. A component of the CSF-1 signal transduction pathway. Phosphorylated DAB2 inhibits adhesion and integrin signaling. Two alternatively spliced isoforms are described.

Protein type: Adaptor/scaffold; Tumor suppressor

Chromosomal Location of Human Ortholog: 5p13.1

Cellular Component: focal adhesion; clathrin-coated vesicle; intracellular membrane-bound organelle; lysosomal membrane; apical plasma membrane; nucleolus; plasma membrane; clathrin coated vesicle membrane; coated pit; clathrin coat of coated pit

Molecular Function: protein C-terminus binding; integrin binding; protein binding; phosphatidylinositol-4,5-bisphosphate binding; SMAD binding

Biological Process: cellular morphogenesis during differentiation; pinocytosis; apoptosis; positive regulation of transcription, DNA-dependent; positive regulation of endocytosis; excretion; activation of JNK activity; clathrin cage assembly; protein transport; positive regulation of RNA elongation from RNA polymerase II promoter; negative regulation of protein binding; positive regulation of receptor recycling; integrin-mediated signaling pathway; receptor-mediated endocytosis; Wnt receptor signaling pathway; in utero embryonic development; leading edge cell differentiation; positive regulation of transforming growth factor beta receptor signaling pathway; cell proliferation; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; myeloid cell differentiation; positive regulation of protein amino acid phosphorylation; negative regulation of transcription, DNA-dependent; positive regulation of cell migration; endoderm development; negative regulation of apoptosis

Research Articles on DAB2

Similar Products

Product Notes

The DAB2 dab2 (Catalog #AAA6221740) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DAB2 (DOC-2, Differentially-expressed Protein 2, Disabled Homolog 2, DOC2) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DAB2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DAB2 dab2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DAB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.