Mouse anti-Human DAB2 Monoclonal Antibody | anti-DAB2 antibody

DAB2 (DOC-2, Differentially-expressed Protein 2, Disabled Homolog 2, DOC2) (HRP)

Cat. Num. AAA6152064

• Gene Names: DAB2; DOC2; DOC-2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DAB2; Monoclonal Antibody; DAB2 (DOC-2; Differentially-expressed Protein 2; Disabled Homolog 2; DOC2) (HRP); anti-DAB2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C8
• Specificity: Recognizes human DAB2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 770

• Applicable Applications for anti-DAB2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa673-770 from human DAB2 (NP_001334) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QTSSGTLSAFASYFNSKVGIPQENADHDDFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Related Product Information for anti-DAB2 antibody

DAB2 is the component of the CSF-1 signal transduction pathway.

Product Categories/Family for anti-DAB2 antibody

Antibodies; Tumor Suppressors

NCBI and Uniprot Product Information

• NCBI GI #: 148491082
• NCBI GeneID: 1601
• NCBI Accession #: NP_001334
• NCBI GenBank Nucleotide #: NM_001343
• UniProt Accession #: P98082
• NCBI Official Full Name: disabled homolog 2 isoform 1
• NCBI Official Synonym Full Names: DAB adaptor protein 2
• NCBI Official Symbol: DAB2
• NCBI Official Synonym Symbols: DOC2; DOC-2
• NCBI Protein Information: disabled homolog 2
• UniProt Protein Name: Disabled homolog 2
• Protein Family: Disabled
• UniProt Gene Name: DAB2
• UniProt Synonym Gene Names: DOC2
• UniProt Entry Name: DAB2_HUMAN

NCBI Description

This gene encodes a mitogen-responsive phosphoprotein. It is expressed in normal ovarian epithelial cells, but is down-regulated or absent from ovarian carcinoma cell lines, suggesting its role as a tumor suppressor. This protein binds to the SH3 domains of GRB2, an adaptor protein that couples tyrosine kinase receptors to SOS (a guanine nucleotide exchange factor for Ras), via its C-terminal proline-rich sequences, and may thus modulate growth factor/Ras pathways by competing with SOS for binding to GRB2. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

DAB2: an adaptor protein that interacts with Grb2, myosin VI, SMAD2/3, DIP1/2, Dvl-3, the integrin betasubunit, and c-Src. Negatively regulates canonical Wnt signaling by stabilizing the beta-catenin degradation complex. A component of the CSF-1 signal transduction pathway. Phosphorylated DAB2 inhibits adhesion and integrin signaling. Two alternatively spliced isoforms are described.

Protein type: Adaptor/scaffold; Tumor suppressor

Chromosomal Location of Human Ortholog: 5p13.1

Cellular Component: focal adhesion; clathrin-coated vesicle; intracellular membrane-bound organelle; lysosomal membrane; apical plasma membrane; nucleolus; plasma membrane; clathrin coated vesicle membrane; coated pit; clathrin coat of coated pit

Molecular Function: protein C-terminus binding; integrin binding; protein binding; phosphatidylinositol-4,5-bisphosphate binding; SMAD binding

Biological Process: cellular morphogenesis during differentiation; pinocytosis; apoptosis; positive regulation of transcription, DNA-dependent; positive regulation of endocytosis; excretion; activation of JNK activity; clathrin cage assembly; protein transport; positive regulation of RNA elongation from RNA polymerase II promoter; negative regulation of protein binding; positive regulation of receptor recycling; integrin-mediated signaling pathway; receptor-mediated endocytosis; Wnt receptor signaling pathway; in utero embryonic development; leading edge cell differentiation; positive regulation of transforming growth factor beta receptor signaling pathway; cell proliferation; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; myeloid cell differentiation; positive regulation of protein amino acid phosphorylation; negative regulation of transcription, DNA-dependent; positive regulation of cell migration; endoderm development; negative regulation of apoptosis