Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human CYP46A1 Monoclonal Antibody | anti-CYP46A1 antibody

CYP46A1 (Cytochrome P450 46A1, Cholesterol 24-hydroxylase, CH24H, CYP46) (HRP)

Gene Names
CYP46A1; CP46; CYP46
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CYP46A1; Monoclonal Antibody; CYP46A1 (Cytochrome P450 46A1; Cholesterol 24-hydroxylase; CH24H; CYP46) (HRP); anti-CYP46A1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A11
Specificity
Recognizes human CYP46A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CYP46A1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa201-300 from human CYP46A1 (NP_006659) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFF
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged CYP46A1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CYP46A1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-CYP46A1 antibody
CYP46A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is expressed in the brain, where it converts cholesterol to 24S-hydroxycholesterol. While cholesterol cannot pass the blood-brain barrier, 24S-hydroxycholesterol can be secreted in the brain into the circulation to be returned to the liver for catabolism.
Product Categories/Family for anti-CYP46A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,315 Da
NCBI Official Full Name
cholesterol 24-hydroxylase
NCBI Official Synonym Full Names
cytochrome P450, family 46, subfamily A, polypeptide 1
NCBI Official Symbol
CYP46A1
NCBI Official Synonym Symbols
CP46; CYP46
NCBI Protein Information
cholesterol 24-hydroxylase; CH24H; cytochrome P450 46A1; cytochrome P450, subfamily 46 (cholesterol 24-hydroxylase)
UniProt Protein Name
Cholesterol 24-hydroxylase
UniProt Gene Name
CYP46A1
UniProt Synonym Gene Names
CYP46; CH24H
UniProt Entry Name
CP46A_HUMAN

Uniprot Description

CYP46A1: Involved in the turnover of cholesterol. It converts cholesterol into 24S-hydroxycholesterol and, to a lesser extent, 25-hydroxycholesterol. Belongs to the cytochrome P450 family.

Protein type: EC 1.14.13.98; Lipid Metabolism - primary bile acid biosynthesis; Membrane protein, integral; Oxidoreductase

Chromosomal Location of Human Ortholog: 14q32.1

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Molecular Function: iron ion binding; cholesterol 24-hydroxylase activity; heme binding; steroid hydroxylase activity

Biological Process: nervous system development; bile acid biosynthetic process; bile acid metabolic process; xenobiotic metabolic process; cholesterol catabolic process; sterol metabolic process

Similar Products

Product Notes

The CYP46A1 cyp46a1 (Catalog #AAA6152054) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CYP46A1 (Cytochrome P450 46A1, Cholesterol 24-hydroxylase, CH24H, CYP46) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP46A1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CYP46A1 cyp46a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CYP46A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.