Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CYP1B1 is ~0.3ng/ml as a capture antibody.)

Mouse anti-Human CYP1B1 Monoclonal Antibody | anti-CYP1B1 antibody

CYP1B1 (Cytochrome P450 1B1, CYPIB1, Cytochrome P450CMEF, Cytochrome P450EF, Cyp1-b1) (HRP)

Gene Names
CYP1B1; CP1B; GLC3A; CYPIB1; P4501B1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CYP1B1; Monoclonal Antibody; CYP1B1 (Cytochrome P450 1B1; CYPIB1; Cytochrome P450CMEF; Cytochrome P450EF; Cyp1-b1) (HRP); anti-CYP1B1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2F8
Specificity
Recognizes human CYP1B1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CYP1B1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa453-542 from human CYP1B1 (NP_000095) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETC
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CYP1B1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CYP1B1 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-CYP1B1 antibody
Cytochrome P450, Family 1, Subfamily B, Polypeptide 1 (CYP1B1) is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP1B1 localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in CYP1B1 have been associated with primary congenital glaucoma; therefore it is thought that CYP1B1 also metabolizes a signaling molecule involved in eye development, possibly a steroid.
Product Categories/Family for anti-CYP1B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,832 Da
NCBI Official Full Name
cytochrome P450 1B1
NCBI Official Synonym Full Names
cytochrome P450, family 1, subfamily B, polypeptide 1
NCBI Official Symbol
CYP1B1
NCBI Official Synonym Symbols
CP1B; GLC3A; CYPIB1; P4501B1
NCBI Protein Information
cytochrome P450 1B1; aryl hydrocarbon hydroxylase; cytochrome P450, subfamily I (dioxin-inducible), polypeptide 1 (glaucoma 3, primary infantile); flavoprotein-linked monooxygenase; microsomal monooxygenase; xenobiotic monooxygenase
UniProt Protein Name
Cytochrome P450, family 1, subfamily B, polypeptide 1, isoform CRA_a
Protein Family
UniProt Gene Name
CYP1B1
UniProt Entry Name
Q53TK1_HUMAN

Similar Products

Product Notes

The CYP1B1 cyp1b1 (Catalog #AAA6152048) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CYP1B1 (Cytochrome P450 1B1, CYPIB1, Cytochrome P450CMEF, Cytochrome P450EF, Cyp1-b1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP1B1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CYP1B1 cyp1b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CYP1B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.