Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for CXCL9 is 0.03ng/ml using MBS609354 as a capture antibody.)

Mouse anti-Human CXCL9 Monoclonal Antibody | anti-CXCL9 antibody

CXCL9 (C-X-C Motif Chemokine 9, CMK, Gamma-interferon-induced Monokine, Humig, Monokine Induced by gamma Interferon, MIG, Small-inducible Cytokine B9, SCYB9) APC

Gene Names
CXCL9; CMK; MIG; Humig; SCYB9; crg-10
Reactivity
Human
Applications
FLISA
Purity
Purified
Synonyms
CXCL9; Monoclonal Antibody; CXCL9 (C-X-C Motif Chemokine 9; CMK; Gamma-interferon-induced Monokine; Humig; Monokine Induced by gamma Interferon; MIG; Small-inducible Cytokine B9; SCYB9) APC; anti-CXCL9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F5
Specificity
Recognizes human CXCL9.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
125
Applicable Applications for anti-CXCL9 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant protein corresponding to aa23-125 of human CXCL9 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for CXCL9 is 0.03ng/ml using MBS609354 as a capture antibody.)

Testing Data (Detection limit for CXCL9 is 0.03ng/ml using MBS609354 as a capture antibody.)
Related Product Information for anti-CXCL9 antibody
CXCL9 acts as a Th1 (type 1 helper T) cell chemoattractant, and plays a role in the growth, activation and movement of cells associated with immune and inflammatory responses, and in tumor growth inhibition and angiogenesis. Studies have shown that CXCL9 is active against E.coli, S.aureus, L. monocytogenes and S.pyogenes.
Product Categories/Family for anti-CXCL9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Chemokine (C-X-C motif) ligand 9
NCBI Official Synonym Full Names
C-X-C motif chemokine ligand 9
NCBI Official Symbol
CXCL9
NCBI Official Synonym Symbols
CMK; MIG; Humig; SCYB9; crg-10
NCBI Protein Information
C-X-C motif chemokine 9
Protein Family

NCBI Description

This antimicrobial gene encodes a protein thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils. [provided by RefSeq, Sep 2014]

Research Articles on CXCL9

Similar Products

Product Notes

The CXCL9 (Catalog #AAA6135030) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CXCL9 (C-X-C Motif Chemokine 9, CMK, Gamma-interferon-induced Monokine, Humig, Monokine Induced by gamma Interferon, MIG, Small-inducible Cytokine B9, SCYB9) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CXCL9 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CXCL9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CXCL9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.