Mouse CTNND2 Monoclonal Antibody | anti-CTNND2 antibody

CTNND2 (Catenin (Cadherin-Associated Protein), delta 2 (Neural Plakophilin-Related arm-Repeat Protein), GT24, NPRAP) (Biotin)

Cat. Num. AAA6174317

• Gene Names: CTNND2; GT24; NPRAP
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: CTNND2; Monoclonal Antibody; CTNND2 (Catenin (Cadherin-Associated Protein); delta 2 (Neural Plakophilin-Related arm-Repeat Protein); GT24; NPRAP) (Biotin); Catenin (Cadherin-Associated Protein); NPRAP; anti-CTNND2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1000
• Specificity: Recognizes CTNND2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CTNND2 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CTNND2 (NP_001323, 1081aa-1190aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGAPAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLG
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CTNND2 is 0.03 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CTNND2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CTNND2 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-CTNND2 antibody

Mouse monoclonal antibody raised against a partial recombinant CTNND2.

Product Categories/Family for anti-CTNND2 antibody

Antibodies; Catenin

NCBI and Uniprot Product Information

• NCBI GI #: 11034811
• NCBI GeneID: 1501
• NCBI Accession #: NP_001323
• NCBI GenBank Nucleotide #: NM_001332
• UniProt Accession #: Q9UQB3
• Molecular Weight: 133kDa
• NCBI Official Full Name: catenin delta-2 isoform 1
• NCBI Official Synonym Full Names: catenin delta 2
• NCBI Official Symbol: CTNND2
• NCBI Official Synonym Symbols: GT24; NPRAP
• NCBI Protein Information: catenin delta-2
• UniProt Protein Name: Catenin delta-2
• Protein Family: Catenin
• UniProt Gene Name: CTNND2
• UniProt Synonym Gene Names: NPRAP
• UniProt Entry Name: CTND2_HUMAN

NCBI Description

This gene encodes an adhesive junction associated protein of the armadillo/beta-catenin superfamily and is implicated in brain and eye development and cancer formation. The protein encoded by this gene promotes the disruption of E-cadherin based adherens junction to favor cell spreading upon stimulation by hepatocyte growth factor. This gene is overexpressed in prostate adenocarcinomas and is associated with decreased expression of tumor suppressor E-cadherin in this tissue. This gene resides in a region of the short arm of chromosome 5 that is deleted in Cri du Chat syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2013]

Uniprot Description

CTNND2: Functions as a transcriptional activator when bound to ZBTB33. May be involved in neuronal cell adhesion and tissue morphogenesis and integrity by regulating adhesion molecules. Binds to E-cadherin at a juxtamembrane site within the cytoplasmic domain. Interacts with PDZD2. Interacts with ZBTB33. Binds to PSEN1. Interacts with RGNEF. Interacts (via the extreme C-terminus) with FRMPD2 (via the PDZ 2 domain). Predominantly expressed in brain; accumulates in cortical neurons. Belongs to the beta-catenin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Actin-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 5p15.2

Cellular Component: adherens junction; cytoplasm; perikaryon; nucleus

Molecular Function: protein binding

Biological Process: cell-cell adhesion; regulation of transcription, DNA-dependent; transcription, DNA-dependent; multicellular organismal development; regulation of synaptic plasticity; morphogenesis of a branching structure; learning; cell adhesion; signal transduction

Disease: Cri-du-chat Syndrome