Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CTNND2 is 0.03 ng/ml as a capture antibody.)

Mouse CTNND2 Monoclonal Antibody | anti-CTNND2 antibody

CTNND2 (Catenin (Cadherin-Associated Protein), delta 2 (Neural Plakophilin-Related arm-Repeat Protein), GT24, NPRAP) (APC)

Gene Names
CTNND2; GT24; NPRAP
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
CTNND2; Monoclonal Antibody; CTNND2 (Catenin (Cadherin-Associated Protein); delta 2 (Neural Plakophilin-Related arm-Repeat Protein); GT24; NPRAP) (APC); Catenin (Cadherin-Associated Protein); NPRAP; anti-CTNND2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1000
Specificity
Recognizes CTNND2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CTNND2 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CTNND2 (NP_001323, 1081aa-1190aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGAPAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLG
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CTNND2 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CTNND2 is 0.03 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CTNND2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CTNND2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CTNND2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CTNND2 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-CTNND2 antibody
Mouse monoclonal antibody raised against a partial recombinant CTNND2.
Product Categories/Family for anti-CTNND2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
133kDa
NCBI Official Full Name
catenin delta-2 isoform 1
NCBI Official Synonym Full Names
catenin delta 2
NCBI Official Symbol
CTNND2
NCBI Official Synonym Symbols
GT24; NPRAP
NCBI Protein Information
catenin delta-2
UniProt Protein Name
Catenin delta-2
Protein Family
UniProt Gene Name
CTNND2
UniProt Synonym Gene Names
NPRAP
UniProt Entry Name
CTND2_HUMAN

NCBI Description

This gene encodes an adhesive junction associated protein of the armadillo/beta-catenin superfamily and is implicated in brain and eye development and cancer formation. The protein encoded by this gene promotes the disruption of E-cadherin based adherens junction to favor cell spreading upon stimulation by hepatocyte growth factor. This gene is overexpressed in prostate adenocarcinomas and is associated with decreased expression of tumor suppressor E-cadherin in this tissue. This gene resides in a region of the short arm of chromosome 5 that is deleted in Cri du Chat syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2013]

Uniprot Description

CTNND2: Functions as a transcriptional activator when bound to ZBTB33. May be involved in neuronal cell adhesion and tissue morphogenesis and integrity by regulating adhesion molecules. Binds to E-cadherin at a juxtamembrane site within the cytoplasmic domain. Interacts with PDZD2. Interacts with ZBTB33. Binds to PSEN1. Interacts with RGNEF. Interacts (via the extreme C-terminus) with FRMPD2 (via the PDZ 2 domain). Predominantly expressed in brain; accumulates in cortical neurons. Belongs to the beta-catenin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Actin-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 5p15.2

Cellular Component: adherens junction; cytoplasm; perikaryon; nucleus

Molecular Function: protein binding

Biological Process: cell-cell adhesion; regulation of transcription, DNA-dependent; transcription, DNA-dependent; multicellular organismal development; regulation of synaptic plasticity; morphogenesis of a branching structure; learning; cell adhesion; signal transduction

Disease: Cri-du-chat Syndrome

Research Articles on CTNND2

Similar Products

Product Notes

The CTNND2 ctnnd2 (Catalog #AAA6169907) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CTNND2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CTNND2 ctnnd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CTNND2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.