Mouse anti-Human CSNK2A1 Monoclonal Antibody | anti-CSNK2A1 antibody

CSNK2A1 (Casein Kinase II Subunit alpha, CK II alpha, CK2A1) (PE)

Cat. Num. AAA6157292

• Gene Names: CSNK2A1; CKII; CK2A1; OCNDS; CSNK2A3
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CSNK2A1; Monoclonal Antibody; CSNK2A1 (Casein Kinase II Subunit alpha; CK II alpha; CK2A1) (PE); anti-CSNK2A1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3D9
• Specificity: Recognizes human CSNK2A1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-CSNK2A1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from human CSNK2A1 (AAH11668) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADI
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of CSNK2A1 expression in transfected 293T cell line by CSNK2A1 monoclonal antibody. Lane 1: CSNK2A1 transfected lysate (45.1kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CSNK2A1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CSNK2A1 is ~3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between TP53 and CSNK2A1 HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and CSNK2A1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Western Blot (WB)

(CSNK2A1 monoclonal antibody, Western Blot analysis of CSNK2A1 expression in Hela NE.)

Product Categories/Family for anti-CSNK2A1 antibody

Antibodies; Protein Kinases

References

1. CK2 Inhibitors Enhance the Radiosensitivity of Human Non-Small Cell Lung Cancer Cells Through Inhibition of Stat3 Activation. Lin YC, Hung MS, Lin CK, Li JM, Lee KD, Li YC, Chen MF, Chen JK, Yang CT.Cancer Biother Radiopharm. 2011 Jun;26(3):381-8. Epub 2011 Jun 28.

NCBI and Uniprot Product Information

• NCBI GI #: 33991298
• NCBI GeneID: 1457
• Molecular Weight: 29,181 Da
• NCBI Official Full Name: Homo sapiens casein kinase 2, alpha 1 polypeptide, mRNA
• NCBI Official Synonym Full Names: casein kinase 2 alpha 1
• NCBI Official Symbol: CSNK2A1
• NCBI Official Synonym Symbols: CKII; CK2A1; OCNDS; CSNK2A3
• NCBI Protein Information: casein kinase II subunit alpha
• Protein Family: Casein kinase

NCBI Description

Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular processes, including cell cycle control, apoptosis, and circadian rhythm. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. The protein encoded by this gene represents the alpha subunit. While this gene is found on chromosome 20, a related transcribed pseudogene is found on chromosome 11. Three transcript variants encoding two different proteins have been found for this gene. [provided by RefSeq, Jul 2014]