Western Blot (WB)
(CRX monoclonal antibody (M02), clone 4G11 Western Blot analysis of CRX expression in IMR-32 (Cat # L008V1).)
Mouse CRX Monoclonal Antibody | anti-CRX antibody
CRX (Cone-rod Homeobox, CORD2, CRD, LCA7, OTX3) (PE)
Gene Names
CRX; CRD; LCA7; OTX3; CORD2
Applications
Western Blot
Purity
Purified
Synonyms
CRX; Monoclonal Antibody; CRX (Cone-rod Homeobox; CORD2; CRD; LCA7; OTX3) (PE); Cone-rod Homeobox; OTX3; anti-CRX antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G11
Specificity
Recognizes CRX.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CRX antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CRX (NP_000545, 1aa-95aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(CRX monoclonal antibody (M02), clone 4G11 Western Blot analysis of CRX expression in IMR-32 (Cat # L008V1).)
Western Blot (WB)
(CRX monoclonal antibody (M02), clone 4G11 Western Blot analysis of CRX expression in IMR-32 (Cat # L008V1).)
Western Blot (WB)
(Western Blot analysis of CRX expression in transfected 293T cell line by CRX monoclonal antibody (M02), clone 4G11.Lane 1: CRX transfected lysate (32 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of CRX expression in transfected 293T cell line by CRX monoclonal antibody (M02), clone 4G11.Lane 1: CRX transfected lysate (32 KDa).Lane 2: Non-transfected lysate.)
Testing Data
(Detection limit for recombinant GST tagged CRX is approximately 0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged CRX is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-CRX antibody
The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined. [provided by RefSeq]
Product Categories/Family for anti-CRX antibody
References
1. From confluent human iPS cells to self-forming neural retina and retinal pigmented epithelium. Reichman S, Terray A, Slembrouck A, Nanteau C, Orieux G, Habeler W, Nandrot EF, Sahel JA, Monville C, Goureau OProc Natl Acad Sci U S A. 2014 Jun 10;111(23):8518-23. doi: 10.1073/pnas.1324212111. Epub 2014 May 27. 2.Mechanistically Distinct Mouse Models for CRX-Associated Retinopathy. Tran NM, Zhang A, Zhang X, Huecker JB, Hennig AK, Chen SPLoS Genet. 2014 Feb 6;10(2):e1004111. doi: 10.1371/journal.pgen.1004111. eCollection 2014 Feb. 3.The expression of retinal cell markers in human retinal pigment epithelial cells and their augmentation by the synthetic retinoid fenretinide.Carr AJ, Vugler AA, Yu L, Semo M, Coffey P, Moss SE, Greenwood J.Mol Vis. 2011;17:1701-15. Epub 2011 Jun 25. 4.Distinct Effects of Hedgehog Signaling on Neuronal Fate Specification and Cell Cycle Progression in the Embryonic Mouse Retina. Sakagami K, Gan L, Yang XJ.J Neurosci. 2009 May 27;29(21):6932-44. 5.BEST1 expression in the retinal pigment epithelium is modulated by OTX family members.Esumi N, Kachi S, Hackler L Jr, Masuda T, Yang Z, Campochiaro PA, Zack DJ.Hum Mol Genet. 2009 Jan 1;18(1):128-41. Epub 2008 Oct 10. 6.Crx activates opsin transcription by recruiting HAT-containing co-activators and promoting histone acetylation.Peng GH, Chen S.Hum Mol Genet. 2007 Oct 15;16(20):3433-52. Epub 2007 Jul 26.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32,261 Da
NCBI Official Full Name
cone-rod homeobox protein
NCBI Official Synonym Full Names
cone-rod homeobox
NCBI Official Symbol
CRX
NCBI Official Synonym Symbols
CRD; LCA7; OTX3; CORD2
NCBI Protein Information
cone-rod homeobox protein; orthodenticle homeobox 3
UniProt Protein Name
Cone-rod homeobox protein
Protein Family
UniProt Gene Name
CRX
UniProt Synonym Gene Names
CORD2
UniProt Entry Name
CRX_HUMAN
Similar Products
Product Notes
The CRX crx (Catalog #AAA6183608) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CRX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRX crx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRX, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
