Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (30.47kD).)

Mouse anti-Human CRH Monoclonal Antibody | anti-CRH antibody

CRH (Corticoliberin, Corticotropin-releasing Factor, Corticotropin-releasing Hormone) APC

Gene Names
CRH; CRF; CRH1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CRH; Monoclonal Antibody; CRH (Corticoliberin; Corticotropin-releasing Factor; Corticotropin-releasing Hormone) APC; anti-CRH antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B11
Specificity
Recognizes human CRH.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CRH antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa154-196 from human CRH (AAH11031) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (30.47kD).)

Western Blot (WB) (Western Blot detection against Immunogen (30.47kD).)

Western Blot (WB)

(Western Blot analysis of CRH expression in transfected 293T cell line by CRH monoclonal antibody. Lane 1: CRH transfected lysate (21.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CRH expression in transfected 293T cell line by CRH monoclonal antibody. Lane 1: CRH transfected lysate (21.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CRH is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CRH is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-CRH antibody
Corticotropin-releasing hormone (CRH) is a 41aa peptide derived from a 191aa preprohormone. CRH is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in CRH has been observed in association with Alzheimer disease and autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, CRH is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. In the placenta CRH is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, CRH may act as a trigger for parturition.
Product Categories/Family for anti-CRH antibody
References
1. RelB/NF-?eB2 Regulates Corticotropin-Releasing Hormone in the Human Placenta. Wang B, Parobchak N, Rosen T.Mol Endocrinol. 2012 Jun 25.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
21,422 Da
NCBI Official Full Name
Homo sapiens corticotropin releasing hormone, mRNA
NCBI Official Synonym Full Names
corticotropin releasing hormone
NCBI Official Symbol
CRH
NCBI Official Synonym Symbols
CRF; CRH1
NCBI Protein Information
corticoliberin
Protein Family

NCBI Description

This gene encodes a member of the corticotropin-releasing factor family. The encoded preproprotein is proteolytically processed to generate the mature neuropeptide hormone. In response to stress, this hormone is secreted by the paraventricular nucleus (PVN) of the hypothalamus, binds to corticotropin releasing hormone receptors and stimulates the release of adrenocorticotropic hormone from the pituitary gland. Marked reduction in this protein has been observed in association with Alzheimer's disease. Autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, this protein is also synthesized in peripheral tissues, such as T lymphocytes, and is highly expressed in the placenta. In the placenta it is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of the hormone occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, this protein may act as a trigger for parturition. [provided by RefSeq, Nov 2015]

Research Articles on CRH

Similar Products

Product Notes

The CRH (Catalog #AAA6136051) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CRH (Corticoliberin, Corticotropin-releasing Factor, Corticotropin-releasing Hormone) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRH can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRH for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.