Mouse COX6B1 Monoclonal Antibody | anti-COX6B1 antibody

COX6B1 (Cytochrome c Oxidase Subunit Vib Polypeptide 1 (ubiquitous), COX6B, COXG) (PE)

Cat. Num. AAA6186622

• Gene Names: COX6B1; COXG; COX6B; COXVIb1
• Applications: Western Blot
• Purity: Purified
• Synonyms: COX6B1; Monoclonal Antibody; COX6B1 (Cytochrome c Oxidase Subunit Vib Polypeptide 1 (ubiquitous); COX6B; COXG) (PE); Cytochrome c Oxidase Subunit Vib Polypeptide 1 (ubiquitous); COXG; anti-COX6B1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2D3
• Specificity: Recognizes COX6B1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 86

• Applicable Applications for anti-COX6B1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: COX6B1 (AAH01015, 1aa-86aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of COX6B1 expression in transfected 293T cell line by COX6B1 monoclonal antibody (M02), clone 2D3.Lane 1: COX6B1 transfected lysate (10.2 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged COX6B1 is approximately 1ng/ml as a capture antibody.)

Related Product Information for anti-COX6B1 antibody

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq]

Product Categories/Family for anti-COX6B1 antibody

Antibodies; Enzymes; Cytochrome

NCBI and Uniprot Product Information

• NCBI GI #: 12654383
• NCBI GeneID: 1340
• NCBI Official Full Name: Cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous)
• NCBI Official Synonym Full Names: cytochrome c oxidase subunit 6B1
• NCBI Official Symbol: COX6B1
• NCBI Official Synonym Symbols: COXG; COX6B; COXVIb1
• NCBI Protein Information: cytochrome c oxidase subunit 6B1
• Protein Family: Cytochrome c oxidase

NCBI Description

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq, Jan 2010]