Mouse anti-Human COPB Monoclonal Antibody | anti-COPB antibody

COPB (Coatomer Subunit beta, Beta-coat Protein, Beta-COP, COPB1, MSTP026) (HRP)

Cat. Num. AAA6151916

• Gene Names: COPB1; COPB
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: COPB; Monoclonal Antibody; COPB (Coatomer Subunit beta; Beta-coat Protein; Beta-COP; COPB1; MSTP026) (HRP); anti-COPB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3E10
• Specificity: Recognizes human COPB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-COPB antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa854-953 from human COPB (NP_057535) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged COPB is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-COPB antibody

The Golgi complex is a key organelle where processing and sorting of newly synthesized proteins occurs. Membrane traffic from the endoplasmic reticulum (ER) to the Golgi complex and from the Golgi complex to the different final cellular destinations is believed to be mediated by carrier vesicles. Two populations of coated vesicles mediate biosynthetic membrane traffic between the different membrane-bound compartments. Clathrin-coated vesicles carry proteins to endocytic organelles and secretory granules, whilst non-clathrin-coated vesicles are involved in intra-Golgi transport and transport from the ER to the Golgi complex. Beta COP is a member of a set of protein which are believed to associate with the non-clathrin coated vesicles. Golgi-derived non-clathrin-coated vesicles are believed to act as bulk carriers, whereas clathrin-coated vesicles carry a selective cargo of membrane proteins.

Product Categories/Family for anti-COPB antibody

Antibodies; Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 7705369
• NCBI GeneID: 1315
• NCBI Accession #: NP_057535
• NCBI GenBank Nucleotide #: NM_016451
• UniProt Accession #: P53618
• Molecular Weight: 107kDa
• NCBI Official Full Name: coatomer subunit beta
• NCBI Official Synonym Full Names: coatomer protein complex subunit beta 1
• NCBI Official Symbol: COPB1
• NCBI Official Synonym Symbols: COPB
• NCBI Protein Information: coatomer subunit beta
• UniProt Protein Name: Coatomer subunit beta
• Protein Family: Copper resistance protein
• UniProt Gene Name: COPB1
• UniProt Synonym Gene Names: COPB; Beta-COP
• UniProt Entry Name: COPB_HUMAN

NCBI Description

This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]