Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged COPB is ~0.3ng/ml as a capture antibody.)

Mouse anti-Human COPB Monoclonal Antibody | anti-COPB antibody

COPB (Coatomer Subunit beta, Beta-coat Protein, Beta-COP, COPB1, MSTP026) (AP)

Gene Names
COPB1; COPB
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
COPB; Monoclonal Antibody; COPB (Coatomer Subunit beta; Beta-coat Protein; Beta-COP; COPB1; MSTP026) (AP); anti-COPB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3E10
Specificity
Recognizes human COPB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-COPB antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa854-953 from human COPB (NP_057535) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged COPB is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged COPB is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-COPB antibody
The Golgi complex is a key organelle where processing and sorting of newly synthesized proteins occurs. Membrane traffic from the endoplasmic reticulum (ER) to the Golgi complex and from the Golgi complex to the different final cellular destinations is believed to be mediated by carrier vesicles. Two populations of coated vesicles mediate biosynthetic membrane traffic between the different membrane-bound compartments. Clathrin-coated vesicles carry proteins to endocytic organelles and secretory granules, whilst non-clathrin-coated vesicles are involved in intra-Golgi transport and transport from the ER to the Golgi complex. Beta COP is a member of a set of protein which are believed to associate with the non-clathrin coated vesicles. Golgi-derived non-clathrin-coated vesicles are believed to act as bulk carriers, whereas clathrin-coated vesicles carry a selective cargo of membrane proteins.
Product Categories/Family for anti-COPB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107kDa
NCBI Official Full Name
coatomer subunit beta
NCBI Official Synonym Full Names
coatomer protein complex subunit beta 1
NCBI Official Symbol
COPB1
NCBI Official Synonym Symbols
COPB
NCBI Protein Information
coatomer subunit beta
UniProt Protein Name
Coatomer subunit beta
Protein Family
UniProt Gene Name
COPB1
UniProt Synonym Gene Names
COPB; Beta-COP
UniProt Entry Name
COPB_HUMAN

NCBI Description

This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]

Research Articles on COPB

Similar Products

Product Notes

The COPB copb1 (Catalog #AAA6130704) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The COPB (Coatomer Subunit beta, Beta-coat Protein, Beta-COP, COPB1, MSTP026) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COPB can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COPB copb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COPB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.