Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human Cofilin 2 Monoclonal Antibody | anti-CFL2 antibody

Cofilin 2 (Cofilin-2, Cofilin, Muscle Isoform, CFL2) (FITC)

Gene Names
CFL2; NEM7
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Cofilin 2; Monoclonal Antibody; Cofilin 2 (Cofilin-2; Cofilin; Muscle Isoform; CFL2) (FITC); anti-CFL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6G9
Specificity
Recognizes human CFL2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CFL2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa57-166 from human CFL2 (NP_068733) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(CFL2 monoclonal antibody. Western Blot analysis of CFL2 expression in HeLa.)

Western Blot (WB) (CFL2 monoclonal antibody. Western Blot analysis of CFL2 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CFL2 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 8ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CFL2 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 8ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CFL2 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CFL2 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CFL2 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CFL2 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-CFL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20.9kDa (186a), confirmed by MALDI-TOF
NCBI Official Full Name
cofilin-2 isoform 1
NCBI Official Synonym Full Names
cofilin 2
NCBI Official Symbol
CFL2
NCBI Official Synonym Symbols
NEM7
NCBI Protein Information
cofilin-2
UniProt Protein Name
Cofilin-2
Protein Family
UniProt Gene Name
CFL2
UniProt Entry Name
COF2_HUMAN

NCBI Description

This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009]

Uniprot Description

Cofilin-2: a cytoskeletal protein that controls actin depolymerization. Has a 5-10-fold higher affinity for ATP-actin monomers than cofilin-1. May promote filament assembly rather than disassembly. Two alternatively spliced variants are described. Isoform b is expressed predominantly in skeletal muscle and heart, while isoform a is expressed in various tissues.

Protein type: Nuclear receptor co-regulator; Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 14q12

Cellular Component: I band; extracellular space; nuclear matrix; actin cytoskeleton

Molecular Function: protein binding; actin binding

Biological Process: muscle maintenance; actin filament depolymerization; positive regulation of actin filament depolymerization; sarcomere organization

Disease: Nemaline Myopathy 7

Research Articles on CFL2

Similar Products

Product Notes

The CFL2 cfl2 (Catalog #AAA6146582) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Cofilin 2 (Cofilin-2, Cofilin, Muscle Isoform, CFL2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cofilin 2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CFL2 cfl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cofilin 2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.