Mouse anti-Human Cofilin 2 Monoclonal Antibody | anti-CFL2 antibody

Cofilin 2 (Cofilin-2, Cofilin, Muscle Isoform, CFL2) (HRP)

Cat. Num. AAA6151885

• Gene Names: CFL2; NEM7
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Cofilin 2; Monoclonal Antibody; Cofilin 2 (Cofilin-2; Cofilin; Muscle Isoform; CFL2) (HRP); anti-CFL2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6G9
• Specificity: Recognizes human CFL2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CFL2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 8ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa57-166 from human CFL2 (NP_068733) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(CFL2 monoclonal antibody. Western Blot analysis of CFL2 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CFL2 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 8ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CFL2 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CFL2 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-CFL2 antibody

Antibodies; Actin

NCBI and Uniprot Product Information

• NCBI GI #: 14719392
• NCBI GeneID: 1073
• NCBI Accession #: NP_068733
• NCBI GenBank Nucleotide #: NM_021914
• UniProt Accession #: Q9Y281; G3V5P4
• Molecular Weight: 20.9kDa (186a), confirmed by MALDI-TOF
• NCBI Official Full Name: cofilin-2 isoform 1
• NCBI Official Synonym Full Names: cofilin 2
• NCBI Official Symbol: CFL2
• NCBI Official Synonym Symbols: NEM7
• NCBI Protein Information: cofilin-2
• UniProt Protein Name: Cofilin-2
• Protein Family: Cofilin
• UniProt Gene Name: CFL2
• UniProt Entry Name: COF2_HUMAN

NCBI Description

This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009]

Uniprot Description

Cofilin-2: a cytoskeletal protein that controls actin depolymerization. Has a 5-10-fold higher affinity for ATP-actin monomers than cofilin-1. May promote filament assembly rather than disassembly. Two alternatively spliced variants are described. Isoform b is expressed predominantly in skeletal muscle and heart, while isoform a is expressed in various tissues.

Protein type: Nuclear receptor co-regulator; Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 14q12

Cellular Component: I band; extracellular space; nuclear matrix; actin cytoskeleton

Molecular Function: protein binding; actin binding

Biological Process: muscle maintenance; actin filament depolymerization; positive regulation of actin filament depolymerization; sarcomere organization

Disease: Nemaline Myopathy 7