Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human, Rat CNR1 Monoclonal Antibody | anti-CNR1 antibody

CNR1 (Cannabinoid Receptor 1, CB-R, CB1, CANN6, CNR) (MaxLight 750)

Gene Names
CNR1; CB1; CNR; CB-R; CB1A; CB1R; CANN6; CB1K5
Reactivity
Human, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CNR1; Monoclonal Antibody; CNR1 (Cannabinoid Receptor 1; CB-R; CB1; CANN6; CNR) (MaxLight 750); anti-CNR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2F9
Specificity
Recognizes human CNR1. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-CNR1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human CNR1 (NP_057167) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CNR1 antibody
CB1 Cannabinoid receptor is associated with the regulation of cognition, memory, and motor activity. The CB1 receptor mediates cannabinoid-induced CNS effects and the addictive behavior experienced by users of marijuana. Three splice variants that are produced by alternative splicing have been identified for this gene.
Product Categories/Family for anti-CNR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
cannabinoid receptor 1 isoform a
NCBI Official Synonym Full Names
cannabinoid receptor 1
NCBI Official Symbol
CNR1
NCBI Official Synonym Symbols
CB1; CNR; CB-R; CB1A; CB1R; CANN6; CB1K5
NCBI Protein Information
cannabinoid receptor 1
UniProt Protein Name
Cannabinoid receptor 1
Protein Family
UniProt Gene Name
CNR1
UniProt Synonym Gene Names
CNR; CB-R; CB1
UniProt Entry Name
CNR1_HUMAN

NCBI Description

This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene. [provided by RefSeq, May 2009]

Uniprot Description

CNR1: Involved in cannabinoid-induced CNS effects. Acts by inhibiting adenylate cyclase. Could be a receptor for anandamide. Inhibits L-type Ca(2+) channel current. Isoform 2 and isoform 3 have altered ligand binding. Belongs to the G-protein coupled receptor 1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 6q14-q15

Cellular Component: growth cone; intracellular membrane-bound organelle; integral to plasma membrane; axon; plasma membrane

Molecular Function: cannabinoid receptor activity; drug binding

Biological Process: response to nicotine; maternal process involved in pregnancy; negative regulation of fatty acid beta-oxidation; regulation of synaptic transmission, glutamatergic; positive regulation of apoptosis; response to morphine; positive regulation of acute inflammatory response to antigenic stimulus; response to lipopolysaccharide; sensory perception of pain; glucose homeostasis; negative regulation of blood pressure; negative regulation of dopamine secretion; response to nutrient; aging; negative regulation of mast cell activation; negative regulation of nitric-oxide synthase activity; axonal fasciculation; negative regulation of action potential; response to cocaine; regulation of synaptic transmission, GABAergic; memory; G-protein signaling, coupled to cAMP nucleotide second messenger; G-protein signaling, coupled to cyclic nucleotide second messenger; response to ethanol; positive regulation of fever; spermatogenesis; regulation of insulin secretion; positive regulation of blood pressure

Research Articles on CNR1

Similar Products

Product Notes

The CNR1 cnr1 (Catalog #AAA6232232) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CNR1 (Cannabinoid Receptor 1, CB-R, CB1, CANN6, CNR) (MaxLight 750) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CNR1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CNR1 cnr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CNR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.