Mouse anti-Human CLEC4E Monoclonal Antibody | anti-CLEC4E antibody

CLEC4E (C-type Lectin Domain Family 4, Member E, C-type Lectin Superfamily Member 9, Macrophage-inducible C-type Lectin, CLECSF9, MINCLE, UNQ218/PRO244) (MaxLight 550)

Cat. Num. AAA6210851

• Gene Names: CLEC4E; MINCLE; CLECSF9
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CLEC4E; Monoclonal Antibody; CLEC4E (C-type Lectin Domain Family 4; Member E; C-type Lectin Superfamily Member 9; Macrophage-inducible C-type Lectin; CLECSF9; MINCLE; UNQ218/PRO244) (MaxLight 550); anti-CLEC4E antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2D12
• Specificity: Recognizes human CLEC4E.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

• Applicable Applications for anti-CLEC4E antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant protein corresponding to aa1-219 from human CLEC4E with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL*
• Conjugate: MaxLight550
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (50.2kD) using 125068.)

Related Product Information for anti-CLEC4E antibody

C-type lectin that functions as cell-surface receptor for a wide variety of ligands such as damaged cells, fungi and mycobacteria. Plays a role in the recognition of pathogenic fungi, such as Candida albicans. The detection of mycobacteria is via trehalose 6,6'-dimycolate (TDM), a cell wall glycolipid. Specifically recognizes alpha-mannose residues on pathogenic fungi of the genus Malassezia. Recognizes also SAP130, a nuclear protein, that is released by dead or dying cells. Transduces signals through an ITAM-containing adapter protein, Fc receptor gamma chain /FCER1G. Induces secretion of inflammatory cytokines through a pathway that depends on SYK, CARD9 and NF-kappa-B.

Product Categories/Family for anti-CLEC4E antibody

Antibodies; Lectins

NCBI and Uniprot Product Information

• NCBI GI #: 33875777
• NCBI GeneID: 26253
• Molecular Weight: 25,073 Da
• NCBI Official Full Name: Homo sapiens C-type lectin domain family 4, member E, mRNA
• NCBI Official Synonym Full Names: C-type lectin domain family 4 member E
• NCBI Official Symbol: CLEC4E
• NCBI Official Synonym Symbols: MINCLE; CLECSF9
• NCBI Protein Information: C-type lectin domain family 4 member E
• Protein Family: C-type lectin domain family

NCBI Description

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008]