C-type lectin domain family 4 member E (Clec4e) Recombinant Protein | Clec4e recombinant protein

Recombinant Mouse C-type lectin domain family 4 member E (Clec4e)

Cat. Num. AAA1408349

• Gene Names: Clec4e; C86253; Mincle; Clecsf9
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-type lectin domain family 4 member E (Clec4e); Recombinant Mouse C-type lectin domain family 4 member E (Clec4e); C-type lectin domain family 4 member E; C-type lectin superfamily member 9; Macrophage-inducible C-type lectin; Clec4e recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 46-214aa; Extracellular Domain
• Sequence: TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD
• Sequence Length: 169

• Species: Mus musculus (Mouse)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for Clec4e recombinant protein

C-type lectin that functions as cell-surface receptor for a wide variety of ligands such as damaged cells, fungi and mycobacteria. Plays a role in the recognition of pathogenic fungi, such as Candida albicans. The detection of mycobacteria is via trehalose 6,6'-dimycolate (TDM), a cell wall glycolipid. Specifically recognizes alpha-mannose residues on pathogenic fungi of the genus Malassezia. Recognizes also SAP130, a nuclear protein, that is released by dead or dying cells. Transduces signals through an ITAM-containing adapter protein, Fc receptor gamma chain /FCER1G. Induces secretion of inflammatory cytokines through a pathway that depends on SYK, CARD9 and NF-kappa-B.

Product Categories/Family for Clec4e recombinant protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 9910162
• NCBI GeneID: 56619
• NCBI Accession #: NP_064332.1
• NCBI GenBank Nucleotide #: NM_019948.2
• UniProt Accession #: Q9R0Q8
• Molecular Weight: 23.6 kDa
• NCBI Official Full Name: C-type lectin domain family 4 member E
• NCBI Official Synonym Full Names: C-type lectin domain family 4, member e
• NCBI Official Symbol: Clec4e
• NCBI Official Synonym Symbols: C86253; Mincle; Clecsf9
• NCBI Protein Information: C-type lectin domain family 4 member E; C-type lectin superfamily member 9; macrophage-inducible C-type lectin; C-type lectin, superfamily member 9; C-type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 9
• UniProt Protein Name: C-type lectin domain family 4 member E
• Protein Family: C-type lectin domain family
• UniProt Gene Name: Clec4e
• UniProt Synonym Gene Names: Clecsf9; Mincle
• UniProt Entry Name: CLC4E_MOUSE

Uniprot Description

CLEC4E: C-type lectin that functions as cell-surface receptor for a wide variety of ligands such as damaged cells, fungi and mycobacteria. Plays a role in the recognition of pathogenic fungi, such as Candida albicans. The detection of mycobacteria is via trehalose 6,6'-dimycolate (TDM), a cell wall glycolipid. Specifically recognizes alpha-mannose residues on pathogenic fungi of the genus Malassezia. Recognizes also SAP130, a nuclear protein, that is released by dead or dying cells. Transduces signals through an ITAM-containing adapter protein, Fc receptor gamma chain /FCER1G. Induces secretion of inflammatory cytokines through a pathway that depends on SYK, CARD9 and NF-kappa-B.

Protein type: Receptor, misc.; Membrane protein, integral

Cellular Component: membrane; integral to membrane

Molecular Function: protein binding; receptor activity; carbohydrate binding

Biological Process: immune system process; immune response; positive regulation of cytokine secretion