Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CLEC2B Monoclonal Antibody | anti-CLEC2B antibody

CLEC2B (AICL, CLECSF2, IFNRG1, C-type Lectin Domain Family 2 Member B, Activation-induced C-type Lectin, C-type Lectin Superfamily Member 2, IFN-alpha-2b-inducing-related Protein 1) (MaxLight 405)

Gene Names
CLEC2B; AICL; IFNRG1; CLECSF2; HP10085
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CLEC2B; Monoclonal Antibody; CLEC2B (AICL; CLECSF2; IFNRG1; C-type Lectin Domain Family 2 Member B; Activation-induced C-type Lectin; C-type Lectin Superfamily Member 2; IFN-alpha-2b-inducing-related Protein 1) (MaxLight 405); anti-CLEC2B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1A2
Specificity
Recognizes human CLEC2B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-CLEC2B antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-149 from human CLEC2B with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEETNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICKKRIH
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CLEC2B antibody
CLEC2B encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell activation antigen.
Product Categories/Family for anti-CLEC2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
17,307 Da
NCBI Official Full Name
Homo sapiens C-type lectin domain family 2, member B, mRNA
NCBI Official Synonym Full Names
C-type lectin domain family 2 member B
NCBI Official Symbol
CLEC2B
NCBI Official Synonym Symbols
AICL; IFNRG1; CLECSF2; HP10085
NCBI Protein Information
C-type lectin domain family 2 member B

NCBI Description

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell activation antigen. An alternative splice variant has been described but its full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008]

Research Articles on CLEC2B

Similar Products

Product Notes

The CLEC2B (Catalog #AAA6189499) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLEC2B (AICL, CLECSF2, IFNRG1, C-type Lectin Domain Family 2 Member B, Activation-induced C-type Lectin, C-type Lectin Superfamily Member 2, IFN-alpha-2b-inducing-related Protein 1) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLEC2B can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLEC2B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLEC2B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.