Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CLEC11A Monoclonal Antibody | anti-CLEC11A antibody

CLEC11A (CLECSF3, LSLCL, SCGF, C-type Lectin Domain Family 11 Member A, C-type Lectin Superfamily Member 3, Lymphocyte Secreted C-type Lectin, Stem Cell Growth Factor, p47) (Biotin)

Gene Names
CLEC11A; P47; SCGF; LSLCL; CLECSF3
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CLEC11A; Monoclonal Antibody; CLEC11A (CLECSF3; LSLCL; SCGF; C-type Lectin Domain Family 11 Member A; C-type Lectin Superfamily Member 3; Lymphocyte Secreted C-type Lectin; Stem Cell Growth Factor; p47) (Biotin); anti-CLEC11A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b, lambda
Clone Number
3E1
Specificity
Recognizes human CLEC11A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CLEC11A antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa214-324 from human CLEC11A (NP_002966) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-CLEC11A antibody
This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined.
Product Categories/Family for anti-CLEC11A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
C-type lectin domain family 11 member A
NCBI Official Synonym Full Names
C-type lectin domain containing 11A
NCBI Official Symbol
CLEC11A
NCBI Official Synonym Symbols
P47; SCGF; LSLCL; CLECSF3
NCBI Protein Information
C-type lectin domain family 11 member A
UniProt Protein Name
C-type lectin domain family 11 member A
UniProt Gene Name
CLEC11A
UniProt Synonym Gene Names
CLECSF3; LSLCL; SCGF
UniProt Entry Name
CLC11_HUMAN

NCBI Description

This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

CLEC11A: Stimulates the proliferation and differentiation of hematopoietic precursor cells from various lineages, including erythrocytes, lymphocytes, granulocytes and macrophages. Acts synergistically with other cytokines, including IL-3, GCSF, GMCSF and FLT3 ligand. Suppresses SCF-stimulated erythrocyte proliferation.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: extracellular space; cytoplasm; extracellular region

Molecular Function: growth factor activity; carbohydrate binding

Biological Process: positive regulation of cell proliferation

Research Articles on CLEC11A

Similar Products

Product Notes

The CLEC11A clec11a (Catalog #AAA6141239) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLEC11A (CLECSF3, LSLCL, SCGF, C-type Lectin Domain Family 11 Member A, C-type Lectin Superfamily Member 3, Lymphocyte Secreted C-type Lectin, Stem Cell Growth Factor, p47) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLEC11A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLEC11A clec11a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLEC11A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.