Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (31.83kD).)

Mouse anti-Human CLDN2 Monoclonal Antibody | anti-CLDN2 antibody

CLDN2 (Claudin-2, SP82, PSEC0059, SP82, UNQ705/PRO1356) (PE)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CLDN2; Monoclonal Antibody; CLDN2 (Claudin-2; SP82; PSEC0059; UNQ705/PRO1356) (PE); anti-CLDN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F1
Specificity
Recognizes human CLDN2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CLDN2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa29-81 from CLDN2 (NP_065117) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (31.83kD).)

Western Blot (WB) (Western Blot detection against Immunogen (31.83kD).)

Testing Data

(Detection limit for recombinant GST tagged CLDN2 is ~0.03ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged CLDN2 is ~0.03ng/ml as a capture antibody)
Related Product Information for anti-CLDN2 antibody
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Product Categories/Family for anti-CLDN2 antibody
References
1. Proteopolymersomes: in vitro production of a membrane protein in polymersome membranes. Nallani M, Andreasson-Ochsner M, Darren Tan CW, Sinner EK, Wisantoso Y, Geifman-Shochat S, Hunziker W.Biointerphases 6, 153 (2011); doi:10.1116/ 1.3644384 2. Probing Effects of pH change on Dynamic Response of Claudin-2 Mediated Adhesion Using Single Molecule Force Spectroscopy. Lim TS, Vedula SR, Huic S, Kausalya PJ, Hunzikerd W, Lim CT.Exp Cell Res. 2008 Aug 15;314(14):2643-51. Epub 2008 Jun 3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,549 Da
NCBI Official Full Name
claudin-2
NCBI Official Synonym Full Names
claudin 2
NCBI Official Symbol
CLDN2
NCBI Protein Information
claudin-2
UniProt Protein Name
Claudin-2
Protein Family
UniProt Gene Name
CLDN2
UniProt Entry Name
CLD2_HUMAN

NCBI Description

This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated region have been found for this gene.[provided by RefSeq, Jan 2010]

Uniprot Description

Claudin-2: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity. Belongs to the claudin family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Cytoskeletal

Chromosomal Location of Human Ortholog: Xq22.3-q23

Cellular Component: tight junction; plasma membrane; integral to membrane

Molecular Function: identical protein binding; structural molecule activity

Biological Process: calcium-independent cell-cell adhesion

Research Articles on CLDN2

Similar Products

Product Notes

The CLDN2 cldn2 (Catalog #AAA6157144) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLDN2 (Claudin-2, SP82, PSEC0059, SP82, UNQ705/PRO1356) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLDN2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLDN2 cldn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLDN2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.