Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.45kD).)

Mouse anti-Human CLASP1 Monoclonal Antibody | anti-CLASP1 antibody

CLASP1 (CLIP-associating Protein 1, Cytoplasmic Linker-associated Protein 1, Multiple Asters Homolog 1, Protein Orbit Homolog 1, hOrbit1, KIAA0622, MAST1) (PE)

Gene Names
CLASP1; MAST1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CLASP1; Monoclonal Antibody; CLASP1 (CLIP-associating Protein 1; Cytoplasmic Linker-associated Protein 1; Multiple Asters Homolog 1; Protein Orbit Homolog 1; hOrbit1; KIAA0622; MAST1) (PE); anti-CLASP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6A11
Specificity
Recognizes human CLASP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1538
Applicable Applications for anti-CLASP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1133-1227 from CLASP1 (NP_056097) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFSFRSQEDLNEPIKRDGKKECDIVSRDGGAASPAT*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.45kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.45kD).)

Testing Data

(Detection limit for recombinant GST tagged CLASP1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CLASP1 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-CLASP1 antibody
CLASP1 is a nonmotor microtubule-associated protein that interacts with CLIPs (cytoplasmic linker proteins). It belongs to a conserved microtubule-binding protein family that mediates the stabilization of overlapping microtubules of the central spindle. CLASP1 promotes the stabilization of dynamic microtubules, and it is required for the polarization of the cytoplasmic microtubule arrays in migrating cells towards the leading edge of the cell. It may act at the cell cortex to enhance the frequency of rescue of depolymerizing microtubules by attaching their plus-ends to cortical platforms, which are composed of ERC1 and PHLDB2. This cortical microtubule stabilizing activity is regulated at least in part by phosphatidylinositol 3-kinase signaling. Moreover, CLASP1 performs a similar stabilizing function at the kinetochore, which is essential for the bipolar alignment of chromosomes on the mitotic spindle.
Product Categories/Family for anti-CLASP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
CLIP-associating protein 1 isoform 1
NCBI Official Synonym Full Names
cytoplasmic linker associated protein 1
NCBI Official Symbol
CLASP1
NCBI Official Synonym Symbols
MAST1
NCBI Protein Information
CLIP-associating protein 1
UniProt Protein Name
CLIP-associating protein 1
Protein Family
UniProt Gene Name
CLASP1
UniProt Synonym Gene Names
KIAA0622; MAST1; hOrbit1
UniProt Entry Name
CLAP1_HUMAN

NCBI Description

CLASPs, such as CLASP1, are nonmotor microtubule-associated proteins that interact with CLIPs (e.g., CLIP170; MIM 179838). CLASP1 is involved in the regulation of microtubule dynamics at the kinetochore and throughout the spindle (Maiato et al., 2003 [PubMed 12837247]).[supplied by OMIM, Mar 2008]

Uniprot Description

CLASP1: Microtubule plus-end tracking protein that promotes the stabilization of dynamic microtubules. Involved in the nucleation of noncentrosomal microtubules originating from the trans-Golgi network (TGN). Required for the polarization of the cytoplasmic microtubule arrays in migrating cells towards the leading edge of the cell. May act at the cell cortex to enhance the frequency of rescue of depolymerizing microtubules by attaching their plus-ends to cortical platforms composed of ERC1 and PHLDB2. This cortical microtubule stabilizing activity is regulated at least in part by phosphatidylinositol 3-kinase signaling. Also performs a similar stabilizing function at the kinetochore which is essential for the bipolar alignment of chromosomes on the mitotic spindle. Belongs to the CLASP family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2q14.2-q14.3

Cellular Component: kinetochore microtubule; kinetochore; Golgi apparatus; centrosome; membrane; cytoplasmic microtubule; spindle microtubule; cortical microtubule cytoskeleton; cell cortex; cytosol

Molecular Function: kinetochore binding; microtubule plus-end binding; protein binding; microtubule binding

Biological Process: axon guidance; microtubule organizing center organization and biogenesis; negative regulation of microtubule depolymerization; organelle organization and biogenesis; negative regulation of microtubule polymerization or depolymerization; establishment and/or maintenance of cell polarity; establishment of spindle orientation; microtubule cytoskeleton organization and biogenesis; microtubule nucleation; cell division; mitotic cell cycle; G2/M transition of mitotic cell cycle; microtubule bundle formation; exit from mitosis

Research Articles on CLASP1

Similar Products

Product Notes

The CLASP1 clasp1 (Catalog #AAA6157134) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLASP1 (CLIP-associating Protein 1, Cytoplasmic Linker-associated Protein 1, Multiple Asters Homolog 1, Protein Orbit Homolog 1, hOrbit1, KIAA0622, MAST1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLASP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLASP1 clasp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLASP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.