Mouse anti-Human CLASP1 Monoclonal Antibody | anti-CLASP1 antibody

CLASP1 (CLIP-associating Protein 1, Cytoplasmic Linker-associated Protein 1, Multiple Asters Homolog 1, Protein Orbit Homolog 1, hOrbit1, KIAA0622, MAST1) (AP)

Cat. Num. AAA6130619

• Gene Names: CLASP1; MAST1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CLASP1; Monoclonal Antibody; CLASP1 (CLIP-associating Protein 1; Cytoplasmic Linker-associated Protein 1; Multiple Asters Homolog 1; Protein Orbit Homolog 1; hOrbit1; KIAA0622; MAST1) (AP); anti-CLASP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6A11
• Specificity: Recognizes human CLASP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 1538

• Applicable Applications for anti-CLASP1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1133-1227 from CLASP1 (NP_056097) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFSFRSQEDLNEPIKRDGKKECDIVSRDGGAASPAT*
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.45kD).)

Testing Data

(Detection limit for recombinant GST tagged CLASP1 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-CLASP1 antibody

CLASP1 is a nonmotor microtubule-associated protein that interacts with CLIPs (cytoplasmic linker proteins). It belongs to a conserved microtubule-binding protein family that mediates the stabilization of overlapping microtubules of the central spindle. CLASP1 promotes the stabilization of dynamic microtubules, and it is required for the polarization of the cytoplasmic microtubule arrays in migrating cells towards the leading edge of the cell. It may act at the cell cortex to enhance the frequency of rescue of depolymerizing microtubules by attaching their plus-ends to cortical platforms, which are composed of ERC1 and PHLDB2. This cortical microtubule stabilizing activity is regulated at least in part by phosphatidylinositol 3-kinase signaling. Moreover, CLASP1 performs a similar stabilizing function at the kinetochore, which is essential for the bipolar alignment of chromosomes on the mitotic spindle.

Product Categories/Family for anti-CLASP1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 31563537
• NCBI GeneID: 23332
• NCBI Accession #: NP_056097
• NCBI GenBank Nucleotide #: NM_015282
• UniProt Accession #: Q7Z460
• NCBI Official Full Name: CLIP-associating protein 1 isoform 1
• NCBI Official Synonym Full Names: cytoplasmic linker associated protein 1
• NCBI Official Symbol: CLASP1
• NCBI Official Synonym Symbols: MAST1
• NCBI Protein Information: CLIP-associating protein 1
• UniProt Protein Name: CLIP-associating protein 1
• Protein Family: CLIP-associating protein
• UniProt Gene Name: CLASP1
• UniProt Synonym Gene Names: KIAA0622; MAST1; hOrbit1
• UniProt Entry Name: CLAP1_HUMAN

NCBI Description

CLASPs, such as CLASP1, are nonmotor microtubule-associated proteins that interact with CLIPs (e.g., CLIP170; MIM 179838). CLASP1 is involved in the regulation of microtubule dynamics at the kinetochore and throughout the spindle (Maiato et al., 2003 [PubMed 12837247]).[supplied by OMIM, Mar 2008]

Uniprot Description

CLASP1: Microtubule plus-end tracking protein that promotes the stabilization of dynamic microtubules. Involved in the nucleation of noncentrosomal microtubules originating from the trans-Golgi network (TGN). Required for the polarization of the cytoplasmic microtubule arrays in migrating cells towards the leading edge of the cell. May act at the cell cortex to enhance the frequency of rescue of depolymerizing microtubules by attaching their plus-ends to cortical platforms composed of ERC1 and PHLDB2. This cortical microtubule stabilizing activity is regulated at least in part by phosphatidylinositol 3-kinase signaling. Also performs a similar stabilizing function at the kinetochore which is essential for the bipolar alignment of chromosomes on the mitotic spindle. Belongs to the CLASP family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2q14.2-q14.3

Cellular Component: kinetochore microtubule; kinetochore; Golgi apparatus; centrosome; membrane; cytoplasmic microtubule; spindle microtubule; cortical microtubule cytoskeleton; cell cortex; cytosol

Molecular Function: kinetochore binding; microtubule plus-end binding; protein binding; microtubule binding

Biological Process: axon guidance; microtubule organizing center organization and biogenesis; negative regulation of microtubule depolymerization; organelle organization and biogenesis; negative regulation of microtubule polymerization or depolymerization; establishment and/or maintenance of cell polarity; establishment of spindle orientation; microtubule cytoskeleton organization and biogenesis; microtubule nucleation; cell division; mitotic cell cycle; G2/M transition of mitotic cell cycle; microtubule bundle formation; exit from mitosis