Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.43kD).)

Mouse anti-Human CKS2 Monoclonal Antibody | anti-CKS2 antibody

CKS2 (Cyclin-dependent Kinases Regulatory Subunit 2, CKS-2) (HRP)

Gene Names
CKS2; CKSHS2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CKS2; Monoclonal Antibody; CKS2 (Cyclin-dependent Kinases Regulatory Subunit 2; CKS-2) (HRP); anti-CKS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2H5-2C4
Specificity
Recognizes human CKS2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CKS2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-79 from human CKS2 (AAH06458) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.43kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.43kD).)

Western Blot (WB)

(Western Blot analysis of CKS2 expression in transfected 293T cell line by CKS2 monoclonal antibody. Lane 1: CKS2 transfected lysate (9.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CKS2 expression in transfected 293T cell line by CKS2 monoclonal antibody. Lane 1: CKS2 transfected lysate (9.9kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CKS2 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CKS2 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CKS2 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CKS2 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-CKS2 antibody
Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.
Product Categories/Family for anti-CKS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
9,860 Da
NCBI Official Full Name
Homo sapiens CDC28 protein kinase regulatory subunit 2, mRNA
NCBI Official Synonym Full Names
CDC28 protein kinase regulatory subunit 2
NCBI Official Symbol
CKS2
NCBI Official Synonym Symbols
CKSHS2
NCBI Protein Information
cyclin-dependent kinases regulatory subunit 2

NCBI Description

CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. [provided by RefSeq, Jul 2008]

Research Articles on CKS2

Similar Products

Product Notes

The CKS2 (Catalog #AAA6151830) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CKS2 (Cyclin-dependent Kinases Regulatory Subunit 2, CKS-2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CKS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CKS2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CKS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.