Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CKS2 on HeLa cell. [antibody concentration 40 ug/ml])

Mouse CKS2 Monoclonal Antibody | anti-CKS2 antibody

CKS2 (CDC28 Protein Kinase Regulatory Subunit 2, CKSHS2) (APC)

Gene Names
CKS2; CKSHS2
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
CKS2; Monoclonal Antibody; CKS2 (CDC28 Protein Kinase Regulatory Subunit 2; CKSHS2) (APC); CDC28 Protein Kinase Regulatory Subunit 2; CKSHS2; anti-CKS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G8
Specificity
Recognizes CKS2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CKS2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CKS2 (NP_001818, 1aa-79aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CKS2 on HeLa cell. [antibody concentration 40 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CKS2 on HeLa cell. [antibody concentration 40 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CKS2 on HeLa cell. [antibody concentration 40 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CKS2 on HeLa cell. [antibody concentration 40 ug/ml])
Related Product Information for anti-CKS2 antibody
CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. [provided by RefSeq]
Product Categories/Family for anti-CKS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.3kDa (94aa), confirmed by MALDI-TOF.
NCBI Official Full Name
cyclin-dependent kinases regulatory subunit 2
NCBI Official Synonym Full Names
CDC28 protein kinase regulatory subunit 2
NCBI Official Symbol
CKS2
NCBI Official Synonym Symbols
CKSHS2
NCBI Protein Information
cyclin-dependent kinases regulatory subunit 2
UniProt Protein Name
Cyclin-dependent kinases regulatory subunit 2
UniProt Gene Name
CKS2
UniProt Synonym Gene Names
CKS-2
UniProt Entry Name
CKS2_HUMAN

NCBI Description

CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. [provided by RefSeq, Jul 2008]

Uniprot Description

CKS2: Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. Belongs to the CKS family.

Protein type: Cell cycle regulation; Protein kinase, regulatory subunit

Chromosomal Location of Human Ortholog: 9q22

Molecular Function: cyclin-dependent protein kinase regulator activity

Biological Process: cell proliferation; cell division; regulation of cyclin-dependent protein kinase activity; meiosis I

Research Articles on CKS2

Similar Products

Product Notes

The CKS2 cks2 (Catalog #AAA6169139) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CKS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CKS2 cks2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CKS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.