Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CILP Monoclonal Antibody | anti-CILP antibody

CILP (Cartilage Intermediate Layer Protein 1, CILP-1, Cartilage Intermediate-layer Protein, UNQ602/PRO1188) (MaxLight 650)

Gene Names
CILP; CILP-1; HsT18872
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CILP; Monoclonal Antibody; CILP (Cartilage Intermediate Layer Protein 1; CILP-1; Cartilage Intermediate-layer Protein; UNQ602/PRO1188) (MaxLight 650); anti-CILP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C5
Specificity
Recognizes human CILP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-CILP antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa129-227 from CILP (NP_003604) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFML*
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CILP antibody
The CILP-1 (cartilage intermediate-layer protein 1) gene product is a 138kD monomeric glycoprotein that is found in both hyaline and fibrocartilage. It is a precursor for two secreted, proteolytically generated products, a 90kD N-terminal CILP-1, and a 62kD C-terminal NTPPHase-homolog. The N-terminus is suggested to serve as both a matrix structural protein, and an IGF-I/TGF-beta1 suppressor sequestration molecule. Human CILP-1 spans aa22-720 of the CILP-1 precursor. It contains one TSP-1 domain (aa149-201) and a C2-type Ig-like region (aa309-395). Over aa1-720 of the CILP-1 precursor, human CILP-1 shares 89% aa identity with mouse CILP-1, and 42% aa identity with human CILP-2.
Product Categories/Family for anti-CILP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
cartilage intermediate layer protein 1 preproprotein
NCBI Official Synonym Full Names
cartilage intermediate layer protein
NCBI Official Symbol
CILP
NCBI Official Synonym Symbols
CILP-1; HsT18872
NCBI Protein Information
cartilage intermediate layer protein 1
UniProt Protein Name
Cartilage intermediate layer protein 1
UniProt Gene Name
CILP
UniProt Entry Name
CILP1_HUMAN

NCBI Description

Major alterations in the composition of the cartilage extracellular matrix occur in joint disease, such as osteoarthrosis. This gene encodes the cartilage intermediate layer protein (CILP), which increases in early osteoarthrosis cartilage. The encoded protein was thought to encode a protein precursor for two different proteins; an N-terminal CILP and a C-terminal homolog of NTPPHase, however, later studies identified no nucleotide pyrophosphatase phosphodiesterase (NPP) activity. The full-length and the N-terminal domain of this protein was shown to function as an IGF-1 antagonist. An allelic variant of this gene has been associated with lumbar disc disease. [provided by RefSeq, Sep 2010]

Research Articles on CILP

Similar Products

Product Notes

The CILP cilp (Catalog #AAA6221494) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CILP (Cartilage Intermediate Layer Protein 1, CILP-1, Cartilage Intermediate-layer Protein, UNQ602/PRO1188) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CILP can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CILP cilp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CILP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.