Mouse anti-Human CILP Monoclonal Antibody | anti-CILP antibody

CILP (Cartilage Intermediate Layer Protein 1, CILP-1, Cartilage Intermediate-layer Protein, UNQ602/PRO1188) (PE)

Cat. Num. AAA6157121

• Gene Names: CILP; CILP-1; HsT18872
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CILP; Monoclonal Antibody; CILP (Cartilage Intermediate Layer Protein 1; CILP-1; Cartilage Intermediate-layer Protein; UNQ602/PRO1188) (PE); anti-CILP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C5
• Specificity: Recognizes human CILP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-CILP antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa129-227 from CILP (NP_003604) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFML*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CILP is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-CILP antibody

The CILP-1 (cartilage intermediate-layer protein 1) gene product is a 138kD monomeric glycoprotein that is found in both hyaline and fibrocartilage. It is a precursor for two secreted, proteolytically generated products, a 90kD N-terminal CILP-1, and a 62kD C-terminal NTPPHase-homolog. The N-terminus is suggested to serve as both a matrix structural protein, and an IGF-I/TGF-beta1 suppressor sequestration molecule. Human CILP-1 spans aa22-720 of the CILP-1 precursor. It contains one TSP-1 domain (aa149-201) and a C2-type Ig-like region (aa309-395). Over aa1-720 of the CILP-1 precursor, human CILP-1 shares 89% aa identity with mouse CILP-1, and 42% aa identity with human CILP-2.

Product Categories/Family for anti-CILP antibody

Antibodies; Extracellular Matrix Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1519313775
• NCBI GeneID: 8483
• NCBI Accession #: NP_003604
• NCBI GenBank Nucleotide #: NM_003613
• UniProt Accession #: O75339
• Molecular Weight: 52kDa
• NCBI Official Full Name: cartilage intermediate layer protein 1 preproprotein
• NCBI Official Synonym Full Names: cartilage intermediate layer protein
• NCBI Official Symbol: CILP
• NCBI Official Synonym Symbols: CILP-1; HsT18872
• NCBI Protein Information: cartilage intermediate layer protein 1
• UniProt Protein Name: Cartilage intermediate layer protein 1
• Protein Family: Cartilage intermediate layer protein
• UniProt Gene Name: CILP
• UniProt Entry Name: CILP1_HUMAN

NCBI Description

Major alterations in the composition of the cartilage extracellular matrix occur in joint disease, such as osteoarthrosis. This gene encodes the cartilage intermediate layer protein (CILP), which increases in early osteoarthrosis cartilage. The encoded protein was thought to encode a protein precursor for two different proteins; an N-terminal CILP and a C-terminal homolog of NTPPHase, however, later studies identified no nucleotide pyrophosphatase phosphodiesterase (NPP) activity. The full-length and the N-terminal domain of this protein was shown to function as an IGF-1 antagonist. An allelic variant of this gene has been associated with lumbar disc disease. [provided by RefSeq, Sep 2010]