Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE (12% SDS-PAGE)

Huntingtin Protein | HTT protein

Huntingtin

Gene Names
HTT; HD; IT15; LOMARS
Applications
ELISA, Western Blot
Purity
>90%
Synonyms
Huntingtin; HD; IT15; Huntington disease protein; HD protein; HTT protein
Ordering
Host
E Coli
Purity/Purification
>90%
Form/Format
50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)
Concentration
1mg/mL (varies by lot)
Sequence Positions
501-680aa
Sequence
SQHTLQADSVDLASCDLTSSATDGDEEDILSHSSSQVSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGTDNQYLGLQIGQPQDEDEEATGILPDEASEAFRNSSMALQQALLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAP
Sequence Length
3144
Applicable Applications for HTT protein
ELISA (EIA), Western Blot (WB), Affinity Purification (AP)
Organism
Homo sapiens(human)
Preparation and Storage
Store at -20 degree C.
Avoid repeated freezing and thawing.

SDS-PAGE

(12% SDS-PAGE)

SDS-PAGE (12% SDS-PAGE)
Related Product Information for HTT protein
recombinant protein with His-tag

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
huntingtin
NCBI Official Synonym Full Names
huntingtin
NCBI Official Symbol
HTT
NCBI Official Synonym Symbols
HD; IT15; LOMARS
NCBI Protein Information
huntingtin
UniProt Protein Name
Huntingtin
Protein Family
UniProt Gene Name
HTT
UniProt Synonym Gene Names
HD; IT15; HD protein

NCBI Description

Huntingtin is a disease gene linked to Huntington's disease, a neurodegenerative disorder characterized by loss of striatal neurons. This is thought to be caused by an expanded, unstable trinucleotide repeat in the huntingtin gene, which translates as a polyglutamine repeat in the protein product. A fairly broad range of trinucleotide repeats (9-35) has been identified in normal controls, and repeat numbers in excess of 40 have been described as pathological. The huntingtin locus is large, spanning 180 kb and consisting of 67 exons. The huntingtin gene is widely expressed and is required for normal development. It is expressed as 2 alternatively polyadenylated forms displaying different relative abundance in various fetal and adult tissues. The larger transcript is approximately 13.7 kb and is expressed predominantly in adult and fetal brain whereas the smaller transcript of approximately 10.3 kb is more widely expressed. The genetic defect leading to Huntington's disease may not necessarily eliminate transcription, but may confer a new property on the mRNA or alter the function of the protein. One candidate is the huntingtin-associated protein-1, highly expressed in brain, which has increased affinity for huntingtin protein with expanded polyglutamine repeats. This gene contains an upstream open reading frame in the 5' UTR that inhibits expression of the huntingtin gene product through translational repression. [provided by RefSeq, Jul 2016]

Uniprot Description

May play a role in microtubule-mediated transport or vesicle function.

Research Articles on HTT

Similar Products

Product Notes

The HTT htt (Catalog #AAA2889005) is a Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 501-680aa. AAA Biotech's Huntingtin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB), Affinity Purification (AP). Researchers should empirically determine the suitability of the HTT htt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SQHTLQADSV DLASCDLTSS ATDGDEEDIL SHSSSQVSAV PSDPAMDLND GTQASSPISD SSQTTTEGPD SAVTPSDSSE IVLDGTDNQY LGLQIGQPQD EDEEATGILP DEASEAFRNS SMALQQALLK NMSHCRQPSD SSVDKFVLRD EATEPGDQEN KPCRIKGDIG QSTDDDSAP. It is sometimes possible for the material contained within the vial of "Huntingtin, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.