Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.33kD).)

Mouse CIAPIN1 Monoclonal Antibody | anti-CIAPIN1 antibody

CIAPIN1 (Anamorsin, Cytokine-induced Apoptosis Inhibitor 1, Fe-S Cluster Assembly Protein DRE2 Homolog, 2810413N20Rik, DRE2, CUA001, PRO0915) (FITC)

Gene Names
CIAPIN1; DRE2; PRO0915; Anamorsin
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CIAPIN1; Monoclonal Antibody; CIAPIN1 (Anamorsin; Cytokine-induced Apoptosis Inhibitor 1; Fe-S Cluster Assembly Protein DRE2 Homolog; 2810413N20Rik; DRE2; CUA001; PRO0915) (FITC); anti-CIAPIN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1, lambda
Clone Number
5G8
Specificity
Recognizes human CIAPIN1. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CIAPIN1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa266-368 from human CIAPIN1 (NP_064709) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.33kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.33kD).)

Western Blot (WB)

(CIAPIN1 monoclonal antibody. Western Blot analysis of CIAPIN1 expression in PC-12.)

Western Blot (WB) (CIAPIN1 monoclonal antibody. Western Blot analysis of CIAPIN1 expression in PC-12.)

Western Blot (WB)

(CIAPIN1 monoclonal antibody. Western Blot analysis of CIAPIN1 expression in HepG2.)

Western Blot (WB) (CIAPIN1 monoclonal antibody. Western Blot analysis of CIAPIN1 expression in HepG2.)

Western Blot (WB)

(CIAPIN1 monoclonal antibody. Western Blot analysis of CIAPIN1 expression in Raw 264.7.)

Western Blot (WB) (CIAPIN1 monoclonal antibody. Western Blot analysis of CIAPIN1 expression in Raw 264.7.)

Testing Data

(Detection limit for recombinant GST tagged CIAPIN1 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CIAPIN1 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-CIAPIN1 antibody
May be required for the maturation of extramitochondrial Fe/S proteins. Has anti-apoptotic effects in the cell. Involved in negative control of cell death upon cytokine withdrawal. Promotes development of hematopoietic cells.
Product Categories/Family for anti-CIAPIN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa (335aa)
NCBI Official Full Name
anamorsin isoform 1
NCBI Official Synonym Full Names
cytokine induced apoptosis inhibitor 1
NCBI Official Symbol
CIAPIN1
NCBI Official Synonym Symbols
DRE2; PRO0915; Anamorsin
NCBI Protein Information
anamorsin
UniProt Protein Name
Anamorsin
Protein Family
UniProt Gene Name
CIAPIN1
UniProt Entry Name
CPIN1_HUMAN

NCBI Description

CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM, Mar 2008]

Uniprot Description

CIAPIN1: May be required for the maturation of extramitochondrial Fe/S proteins. Has anti-apoptotic effects in the cell. Involved in negative control of cell death upon cytokine withdrawal. Promotes development of hematopoietic cells. Belongs to the anamorsin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 16q21

Cellular Component: nucleoplasm; cytoplasm; nucleolus; mitochondrial intermembrane space

Molecular Function: 2 iron, 2 sulfur cluster binding; protein binding; electron carrier activity; metal ion binding

Biological Process: apoptosis; iron-sulfur cluster assembly; hemopoiesis; negative regulation of apoptosis

Research Articles on CIAPIN1

Similar Products

Product Notes

The CIAPIN1 ciapin1 (Catalog #AAA6146509) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CIAPIN1 (Anamorsin, Cytokine-induced Apoptosis Inhibitor 1, Fe-S Cluster Assembly Protein DRE2 Homolog, 2810413N20Rik, DRE2, CUA001, PRO0915) (FITC) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CIAPIN1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CIAPIN1 ciapin1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CIAPIN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.