Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human Choline Acetyltransferase Monoclonal Antibody | anti-CHAT antibody

Choline Acetyltransferase (CHAT, CMS1A, CMS1A2, Acetyl CoA:choline O-acetyltransferase) (AP)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Choline Acetyltransferase; Monoclonal Antibody; Choline Acetyltransferase (CHAT; CMS1A; CMS1A2; Acetyl CoA:choline O-acetyltransferase) (AP); anti-CHAT antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1H7
Specificity
Recognizes human CHAT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
748
Applicable Applications for anti-CHAT antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa649-748 from human CHAT (NP_065574) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPSQGHQP
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)
Related Product Information for anti-CHAT antibody
Choline acetyltransferase is a neuronal enzyme which catalyzes the reaction between Acetyl CoA and choline resulting in the formation of acetylcholine. It is therefore found primarily in cholinergic neurons making it a valuable marker for diseases associated with decreased cholinergic function such as Schizophrenia, Alzheimer disease (AD) and Down syndrome (Holt et al. 1999). Decreased choline acetyltransferase activity in particular has been shown in Schizophrenic subjects (Karson et al 1993). It has furthermore been demonstrated that in patients with AD, there are significantly lower levels of cortical ChAT that correlate with severity of the disease as measured by loss of neuropsychological function (Baskin et al. 1999).
Product Categories/Family for anti-CHAT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
choline O-acetyltransferase isoform 2

Similar Products

Product Notes

The CHAT (Catalog #AAA6130581) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Choline Acetyltransferase (CHAT, CMS1A, CMS1A2, Acetyl CoA:choline O-acetyltransferase) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Choline Acetyltransferase can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHAT for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Choline Acetyltransferase, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.