Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CHMP2B Monoclonal Antibody | anti-CHMP2B antibody

CHMP2B (Charged Multivesicular Body Protein 2b, CHMP2.5, Chromatin-modifying Protein 2b, CHMP2b, Vacuolar Protein Sorting-associated Protein 2-2, Vps2-2, hVps2-2, CGI-84) (MaxLight 650)

Gene Names
CHMP2B; DMT1; ALS17; VPS2B; VPS2-2; CHMP2.5
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CHMP2B; Monoclonal Antibody; CHMP2B (Charged Multivesicular Body Protein 2b; CHMP2.5; Chromatin-modifying Protein 2b; CHMP2b; Vacuolar Protein Sorting-associated Protein 2-2; Vps2-2; hVps2-2; CGI-84) (MaxLight 650); anti-CHMP2B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2H6-1E6
Specificity
Recognizes human CHMP2B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-CHMP2B antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-213 from human CHMP2B (AAH01553) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CHMP2B antibody
CHMP2B (CHarged Multivescular body Protein 2B also Chromatin Modifying Protein 2B and Vps22) is a 35kD member of the SNF family of proteins. It is a cytosolic molecule that interacts with VPS4 and undergoes polymerization to form tubules that project plasma membrane outward, generating an environment conducive to membrane fission and budding. It also appears to participate in the formation of intraluminal vesicles associated with the lysosomal system. CHMP2B is found in striated muscle (heart and skeletal), and particularly in neurons of the CNS. Human CHMP2B is 213aa in length. It contains one coiled-coil region (aa25-55), an MIT (microtubule-interacting and trafficking) domain (aa201-211) and a utilized phosphorylation site at Ser199. There is one alternative splice form that shows a deletion of aa2-42. Full length human CHMP2B shares 99% aa identity with mouse CHMP2B, but only 33% aa identity with human CHMP2A.
Product Categories/Family for anti-CHMP2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
19,100 Da
NCBI Official Full Name
Homo sapiens chromatin modifying protein 2B, mRNA
NCBI Official Synonym Full Names
charged multivesicular body protein 2B
NCBI Official Symbol
CHMP2B
NCBI Official Synonym Symbols
DMT1; ALS17; VPS2B; VPS2-2; CHMP2.5
NCBI Protein Information
charged multivesicular body protein 2b

NCBI Description

This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq, Jul 2008]

Research Articles on CHMP2B

Similar Products

Product Notes

The CHMP2B (Catalog #AAA6221466) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CHMP2B (Charged Multivesicular Body Protein 2b, CHMP2.5, Chromatin-modifying Protein 2b, CHMP2b, Vacuolar Protein Sorting-associated Protein 2-2, Vps2-2, hVps2-2, CGI-84) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHMP2B can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHMP2B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHMP2B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.