Mouse anti-Human CHMP2B Monoclonal Antibody | anti-CHMP2B antibody

CHMP2B (Charged Multivesicular Body Protein 2b, CHMP2.5, Chromatin-modifying Protein 2b, CHMP2b, Vacuolar Protein Sorting-associated Protein 2-2, Vps2-2, hVps2-2, CGI-84) (PE)

Cat. Num. AAA6157093

• Gene Names: CHMP2B; DMT1; ALS17; VPS2B; VPS2-2; CHMP2.5
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CHMP2B; Monoclonal Antibody; CHMP2B (Charged Multivesicular Body Protein 2b; CHMP2.5; Chromatin-modifying Protein 2b; CHMP2b; Vacuolar Protein Sorting-associated Protein 2-2; Vps2-2; hVps2-2; CGI-84) (PE); anti-CHMP2B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2H6-1E6
• Specificity: Recognizes human CHMP2B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-CHMP2B antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-213 from human CHMP2B (AAH01553) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CHMP2B is ~1ng/ml as a capture antibody.)

Related Product Information for anti-CHMP2B antibody

CHMP2B (CHarged Multivescular body Protein 2B also Chromatin Modifying Protein 2B and Vps22) is a 35kD member of the SNF family of proteins. It is a cytosolic molecule that interacts with VPS4 and undergoes polymerization to form tubules that project plasma membrane outward, generating an environment conducive to membrane fission and budding. It also appears to participate in the formation of intraluminal vesicles associated with the lysosomal system. CHMP2B is found in striated muscle (heart and skeletal), and particularly in neurons of the CNS. Human CHMP2B is 213aa in length. It contains one coiled-coil region (aa25-55), an MIT (microtubule-interacting and trafficking) domain (aa201-211) and a utilized phosphorylation site at Ser199. There is one alternative splice form that shows a deletion of aa2-42. Full length human CHMP2B shares 99% aa identity with mouse CHMP2B, but only 33% aa identity with human CHMP2A.

Product Categories/Family for anti-CHMP2B antibody

Antibodies; Transport Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 16306738
• NCBI GeneID: 25978
• Molecular Weight: 19,100 Da
• NCBI Official Full Name: Homo sapiens chromatin modifying protein 2B, mRNA
• NCBI Official Synonym Full Names: charged multivesicular body protein 2B
• NCBI Official Symbol: CHMP2B
• NCBI Official Synonym Symbols: DMT1; ALS17; VPS2B; VPS2-2; CHMP2.5
• NCBI Protein Information: charged multivesicular body protein 2b
• Protein Family: Charged multivesicular body protein

NCBI Description

This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq, Jul 2008]