Mouse anti-Human CHD4 Monoclonal Antibody | anti-CHD4 antibody

CHD4 (Chromodomain-helicase-DNA-binding Protein 4, CHD-4, ATP-dependent Helicase CHD4, Mi-2 Autoantigen 218kD Protein, Mi2-beta) APC

Cat. Num. AAA6135875

• Gene Names: CHD4; CHD-4; Mi-2b; Mi2-BETA
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CHD4; Monoclonal Antibody; CHD4 (Chromodomain-helicase-DNA-binding Protein 4; CHD-4; ATP-dependent Helicase CHD4; Mi-2 Autoantigen 218kD Protein; Mi2-beta) APC; anti-CHD4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4H4
• Specificity: Recognizes human CHD4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-CHD4 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1632-1730 from human CHD4 (NP_001264) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(CHD4 monoclonal antibody, Western Blot analysis of CHD4 expression in HeLa NE.)

Western Blot (WB)

(Western Blot analysis of CHD4 expression in transfected 293T cell line by CHD4 monoclonal antibody. Lane 1: CHD4 transfected lysate (22kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CHD4 on formalin-fixed paraffin-embedded human transitional cell carcinoma. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CHD4 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-CHD4 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 51599156
• NCBI GeneID: 1108
• NCBI Accession #: NP_001264
• NCBI GenBank Nucleotide #: NM_001273
• UniProt Accession #: Q14839; Q8IXZ5
• Molecular Weight: 220,848 Da
• NCBI Official Full Name: chromodomain-helicase-DNA-binding protein 4 isoform 1
• NCBI Official Synonym Full Names: chromodomain helicase DNA binding protein 4
• NCBI Official Symbol: CHD4
• NCBI Official Synonym Symbols: CHD-4; Mi-2b; Mi2-BETA
• NCBI Protein Information: chromodomain-helicase-DNA-binding protein 4; ATP-dependent helicase CHD4; Mi-2 autoantigen 218 kDa protein
• UniProt Protein Name: Chromodomain-helicase-DNA-binding protein 4
• Protein Family: Chromodomain-helicase-DNA-binding protein
• UniProt Gene Name: CHD4
• UniProt Synonym Gene Names: CHD-4
• UniProt Entry Name: CHD4_HUMAN

Uniprot Description

CHD-4: is an ATP-dependent helicase and a central component of the HDAC-containing nucleosome remodeling and histone deacetylase (NuRD) transcriptional complex. Interacts with MTA1/2, HDAC1, and RbAp46 in the NuRD complex. CHD-4 belongs to the SNF2/RAD54 helicase family of proteins. The NuRD complex, whose subunit composition varies by cell type and in response to physiologic signals, plays central roles in many processes including oncogenesis and metastasis, B cell differentiation, invasive growth of breast cancer, and maintaining the balance between the undifferentiated state and the process of differentiation in embryonic stem cells.

Protein type: Helicase; DNA-binding; EC 3.6.4.12

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: nucleoplasm; centrosome; protein complex; membrane; nuclear chromatin; cytoplasm; NuRD complex; nucleus

Molecular Function: ATP-dependent DNA helicase activity; protein binding; nucleosomal DNA binding; DNA binding; zinc ion binding; microtubule binding; ATP binding

Biological Process: regulation of transcription from RNA polymerase II promoter; establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; ATP-dependent chromatin remodeling; spindle assembly; DNA duplex unwinding