Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.59kD).)

Mouse anti-Human, Rat FAM189A2 Monoclonal Antibody | anti-FAM189A2 antibody

FAM189A2 (C9orf61, X123, Protein FAM189A2, Protein X123) APC

Gene Names
FAM189A2; X123; ENTREP; C9orf61
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FAM189A2; Monoclonal Antibody; FAM189A2 (C9orf61; X123; Protein FAM189A2; Protein X123) APC; anti-FAM189A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H3
Specificity
Recognizes human C9orf61. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
2454
Applicable Applications for anti-FAM189A2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa383-451 from C9orf61 (NP_004807) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QIMAPLQPSTSRAHRLPSRRQPGLLHLQSCGDLHTFTPAGRPRAERRPRRVEAERPHSLIGVIRETVL*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.59kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.59kD).)

Western Blot (WB)

(C9orf61 monoclonal antibody Western Blot analysis of C9orf61 expression in PC-12)

Western Blot (WB) (C9orf61 monoclonal antibody Western Blot analysis of C9orf61 expression in PC-12)

Testing Data

(Detection limit for recombinant GST tagged C9orf61 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged C9orf61 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-FAM189A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens family with sequence similarity 189 member A2 (FAM189A2), transcript variant 1, mRNA
NCBI Official Synonym Full Names
family with sequence similarity 189 member A2
NCBI Official Symbol
FAM189A2
NCBI Official Synonym Symbols
X123; ENTREP; C9orf61
NCBI Protein Information
protein FAM189A2
UniProt Protein Name
Protein FAM189A2
Protein Family
UniProt Gene Name
FAM189A2
UniProt Synonym Gene Names
C9orf61; X123
UniProt Entry Name
F1892_HUMAN

Uniprot Description

FAM189A2: Belongs to the FAM189 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 9q21.11

Cellular Component: integral to membrane

Similar Products

Product Notes

The FAM189A2 fam189a2 (Catalog #AAA6136527) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FAM189A2 (C9orf61, X123, Protein FAM189A2, Protein X123) APC reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FAM189A2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FAM189A2 fam189a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FAM189A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.