Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human CHD4 Monoclonal Antibody | anti-CHD4 antibody

CHD4 (Chromodomain-helicase-DNA-binding Protein 4, CHD-4, ATP-dependent Helicase CHD4, Mi-2 Autoantigen 218kD Protein, Mi2-beta) (Biotin)

Gene Names
CHD4; CHD-4; Mi-2b; Mi2-BETA
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CHD4; Monoclonal Antibody; CHD4 (Chromodomain-helicase-DNA-binding Protein 4; CHD-4; ATP-dependent Helicase CHD4; Mi-2 Autoantigen 218kD Protein; Mi2-beta) (Biotin); anti-CHD4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H4
Specificity
Recognizes human CHD4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CHD4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1632-1730 from human CHD4 (NP_001264) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(CHD4 monoclonal antibody, Western Blot analysis of CHD4 expression in HeLa NE.)

Western Blot (WB) (CHD4 monoclonal antibody, Western Blot analysis of CHD4 expression in HeLa NE.)

Western Blot (WB)

(Western Blot analysis of CHD4 expression in transfected 293T cell line by CHD4 monoclonal antibody. Lane 1: CHD4 transfected lysate (22kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CHD4 expression in transfected 293T cell line by CHD4 monoclonal antibody. Lane 1: CHD4 transfected lysate (22kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CHD4 on formalin-fixed paraffin-embedded human transitional cell carcinoma. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CHD4 on formalin-fixed paraffin-embedded human transitional cell carcinoma. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CHD4 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CHD4 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-CHD4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
220,848 Da
NCBI Official Full Name
chromodomain-helicase-DNA-binding protein 4 isoform 1
NCBI Official Synonym Full Names
chromodomain helicase DNA binding protein 4
NCBI Official Symbol
CHD4
NCBI Official Synonym Symbols
CHD-4; Mi-2b; Mi2-BETA
NCBI Protein Information
chromodomain-helicase-DNA-binding protein 4; ATP-dependent helicase CHD4; Mi-2 autoantigen 218 kDa protein
UniProt Protein Name
Chromodomain-helicase-DNA-binding protein 4
UniProt Gene Name
CHD4
UniProt Synonym Gene Names
CHD-4
UniProt Entry Name
CHD4_HUMAN

Uniprot Description

CHD-4: is an ATP-dependent helicase and a central component of the HDAC-containing nucleosome remodeling and histone deacetylase (NuRD) transcriptional complex. Interacts with MTA1/2, HDAC1, and RbAp46 in the NuRD complex. CHD-4 belongs to the SNF2/RAD54 helicase family of proteins. The NuRD complex, whose subunit composition varies by cell type and in response to physiologic signals, plays central roles in many processes including oncogenesis and metastasis, B cell differentiation, invasive growth of breast cancer, and maintaining the balance between the undifferentiated state and the process of differentiation in embryonic stem cells.

Protein type: Helicase; DNA-binding; EC 3.6.4.12

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: nucleoplasm; centrosome; protein complex; membrane; nuclear chromatin; cytoplasm; NuRD complex; nucleus

Molecular Function: ATP-dependent DNA helicase activity; protein binding; nucleosomal DNA binding; DNA binding; zinc ion binding; microtubule binding; ATP binding

Biological Process: regulation of transcription from RNA polymerase II promoter; establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; ATP-dependent chromatin remodeling; spindle assembly; DNA duplex unwinding

Similar Products

Product Notes

The CHD4 chd4 (Catalog #AAA6141178) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CHD4 (Chromodomain-helicase-DNA-binding Protein 4, CHD-4, ATP-dependent Helicase CHD4, Mi-2 Autoantigen 218kD Protein, Mi2-beta) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHD4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHD4 chd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHD4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.