Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against immunogen (33.48kD).)

Mouse anti-Human CFC1 Monoclonal Antibody | anti-CFC1 antibody

CFC1 (Cryptic Protein, Cryptic Family Protein 1, CFC1B, CRYPTIC, FLJ77897, HTX2, MGC133213) APC

Gene Names
CFC1; HTX2; CFC1B; DTGA2; CRYPTIC
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CFC1; Monoclonal Antibody; CFC1 (Cryptic Protein; Cryptic Family Protein 1; CFC1B; CRYPTIC; FLJ77897; HTX2; MGC133213) APC; anti-CFC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G4
Specificity
Recognizes human CFC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CFC1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa27-93 from human CFC1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYSRAFGEGASARPRCCRN
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (33.48kD).)

Western Blot (WB) (Western Blot detection against immunogen (33.48kD).)

Immunoprecipitation (IP)

(Immunoprecipitation of CFC1 transfected lysate using and Protein A Magnetic Bead and immunoblotted with CFC1 Pab rabbit polyclonal)

Immunoprecipitation (IP) (Immunoprecipitation of CFC1 transfected lysate using and Protein A Magnetic Bead and immunoblotted with CFC1 Pab rabbit polyclonal)

Testing Data

(Detection limit is 0.3ng/ml using as a capture antibody.)

Testing Data (Detection limit is 0.3ng/ml using as a capture antibody.)
Related Product Information for anti-CFC1 antibody
NODAL coreceptor involved in the correct establishment of the left-right axis. May play a role in mesoderm and/or neural patterning during gastrulation.
Product Categories/Family for anti-CFC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,612 Da
NCBI Official Full Name
cryptic protein isoform 1
NCBI Official Synonym Full Names
cripto, FRL-1, cryptic family 1
NCBI Official Symbol
CFC1
NCBI Official Synonym Symbols
HTX2; CFC1B; DTGA2; CRYPTIC
NCBI Protein Information
cryptic protein; cryptic family protein 1; heterotaxy 2 (autosomal dominant)
UniProt Protein Name
Cryptic protein
Protein Family
UniProt Gene Name
CFC1
UniProt Entry Name
CFC1_HUMAN

NCBI Description

This gene encodes a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family, which are involved in signalling during embryonic development. Proteins in this family share a variant EGF-like motif, a conserved cysteine-rich domain, and a C-terminal hydrophobic region. The protein encoded by this gene is necessary for patterning the left-right embryonic axis. Mutations in this gene are associated with defects in organ development, including autosomal visceral heterotaxy and congenital heart disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

CFC1: NODAL coreceptor involved in the correct establishment of the left-right axis. May play a role in mesoderm and/or neural patterning during gastrulation. Defects in CFC1 are the cause of visceral heterotaxy autosomal type 2 (HTX2). A form of visceral heterotaxy, a complex disorder due to disruption of the normal left-right asymmetry of the thoracoabdominal organs. It results in an abnormal arrangement of visceral organs, and a wide variety of congenital defects including cardiac malformations and situs inversus or situs ambiguus. Defects in CFC1 are a cause of transposition of the great arteries dextro-looped type 2 (DTGA2). A congenital heart defect consisting of complete inversion of the great vessels, so that the aorta incorrectly arises from the right ventricle and the pulmonary artery incorrectly arises from the left ventricle. This creates completely separate pulmonary and systemic circulatory systems, an arrangement that is incompatible with life. Patients often have atrial and/or ventricular septal defects or other types of shunting that allow some mixing between the circulations in order to support life minimally, but surgical intervention is always required. Defects in CFC1 are a cause of conotruncal heart malformations (CTHM). CTHM consist of cardiac outflow tract defects, such as tetralogy of Fallot, pulmonary atresia, double-outlet right ventricle, truncus arteriosus communis, and aortic arch anomalies.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 2q21.1

Cellular Component: plasma membrane; extracellular region

Biological Process: gastrulation; determination of left/right symmetry

Disease: Heterotaxy, Visceral, 2, Autosomal; Conotruncal Heart Malformations; Transposition Of The Great Arteries, Dextro-looped 2

Research Articles on CFC1

Similar Products

Product Notes

The CFC1 cfc1 (Catalog #AAA6135856) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CFC1 (Cryptic Protein, Cryptic Family Protein 1, CFC1B, CRYPTIC, FLJ77897, HTX2, MGC133213) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CFC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CFC1 cfc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CFC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.