Mouse anti-Human CENPH Monoclonal Antibody | anti-CENPH antibody

CENPH (Centromere Protein H, CENP-H, Interphase Centromere Complex Protein 35, ICEN35) APC

Cat. Num. AAA6135847

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CENPH; Monoclonal Antibody; CENPH (Centromere Protein H; CENP-H; Interphase Centromere Complex Protein 35; ICEN35) APC; anti-CENPH antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F7
• Specificity: Recognizes human CENPH.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-CENPH antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant corresponding to aa1-248 from human CENPH (AAH12024) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (53.28kD).)

Western Blot (WB)

(Western Blot analysis of CENPH expression in transfected 293T cell line by CENPH monoclonal antibody. Lane 1: CENPH transfected lysate (28.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CENPH is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-CENPH antibody

Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate.

Product Categories/Family for anti-CENPH antibody

Antibodies; Centromeres

NCBI and Uniprot Product Information

• NCBI GI #: 15080567
• NCBI GeneID: 64946
• Molecular Weight: 28,481 Da
• NCBI Official Full Name: Homo sapiens centromere protein H, mRNA
• NCBI Official Synonym Full Names: centromere protein H
• NCBI Official Symbol: CENPH
• NCBI Protein Information: centromere protein H
• Protein Family: Centromere protein

NCBI Description

Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interphase and metaphase. It localizes outside of centromeric heterochromatin, where CENP-B is localized, and inside the kinetochore corona, where CENP-E is localized during prometaphase. It is thought that this protein can bind to itself, as well as to CENP-A, CENP-B or CENP-C. Multimers of the protein localize constitutively to the inner kinetochore plate and play an important role in the organization and function of the active centromere-kinetochore complex. [provided by RefSeq, Jul 2008]