Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CEBPG expression in transfected 293T cell line by CEBPG monoclonal antibody (M03), clone S2.Lane 1: CEBPG transfected lysate(16.4 KDa).Lane 2: Non-transfected lysate.)

Mouse CEBPG Monoclonal Antibody | anti-CEBPG antibody

CEBPG (CCAAT/Enhancer Binding Protein (C/EBP), gamma, GPE1BP, IG/EBP-1) (AP)

Gene Names
CEBPG; GPE1BP; IG/EBP-1
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
CEBPG; Monoclonal Antibody; CEBPG (CCAAT/Enhancer Binding Protein (C/EBP); gamma; GPE1BP; IG/EBP-1) (AP); CCAAT/Enhancer Binding Protein (C/EBP); IG/EBP-1; anti-CEBPG antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
S2
Specificity
Recognizes CEBPG.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
150
Applicable Applications for anti-CEBPG antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CEBPG (AAH13128, 1aa-150aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CEBPG expression in transfected 293T cell line by CEBPG monoclonal antibody (M03), clone S2.Lane 1: CEBPG transfected lysate(16.4 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CEBPG expression in transfected 293T cell line by CEBPG monoclonal antibody (M03), clone S2.Lane 1: CEBPG transfected lysate(16.4 KDa).Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of CEBPG transfected lysate using anti-CEBPG monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with CEBPG MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of CEBPG transfected lysate using anti-CEBPG monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with CEBPG MaxPab rabbit polyclonal antibody.)
Product Categories/Family for anti-CEBPG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
CCAAT/enhancer binding protein (C/EBP), gamma
NCBI Official Synonym Full Names
CCAAT enhancer binding protein gamma
NCBI Official Symbol
CEBPG
NCBI Official Synonym Symbols
GPE1BP; IG/EBP-1
NCBI Protein Information
CCAAT/enhancer-binding protein gamma

NCBI Description

The C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein: a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. The C/EBP family consist of several related proteins, C/EBP alpha, C/EBP beta, C/EBP gamma, and C/EBP delta, that form homodimers and that form heterodimers with each other. CCAAT/enhancer binding protein gamma may cooperate with Fos to bind PRE-I enhancer elements. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2011]

Research Articles on CEBPG

Similar Products

Product Notes

The CEBPG (Catalog #AAA6163906) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CEBPG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CEBPG for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CEBPG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.