Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.86kD).)

Mouse anti-Human CDY2A Monoclonal Antibody | anti-CDY2A antibody

CDY2A (Testis-specific Chromodomain Protein Y 2, CDY2B, CDY2)

Gene Names
CDY2A; CDY; CDY2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CDY2A; Monoclonal Antibody; CDY2A (Testis-specific Chromodomain Protein Y 2; CDY2B; CDY2); Anti -CDY2A (Testis-specific Chromodomain Protein Y 2; anti-CDY2A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E2
Specificity
Recognizes human CDY2A.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
ASTLSDTKNMEIINSTIETLAPDSPFDHKKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSHPGAEQTGIQNKTQMHPLMSQMSGS
Applicable Applications for anti-CDY2A antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa123-214 from CDY2A (NP_004816) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.86kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.86kD).)

Testing Data

(Detection limit for recombinant GST tagged CDY2A is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CDY2A is 1ng/ml as a capture antibody.)
Related Product Information for anti-CDY2A antibody
May have histone acetyltransferase activity.
Product Categories/Family for anti-CDY2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
60,524 Da
NCBI Official Full Name
CDY2A protein
NCBI Official Synonym Full Names
chromodomain protein, Y-linked, 2A
NCBI Official Symbol
CDY2A
NCBI Official Synonym Symbols
CDY; CDY2
NCBI Protein Information
testis-specific chromodomain protein Y 2; Y chromosome chromodomain protein 2A; chromodomain protein, Y chromosome, 2
UniProt Protein Name
Testis-specific chromodomain protein Y 2
UniProt Gene Name
CDY2A
UniProt Synonym Gene Names
CDY2
UniProt Entry Name
CDY2_HUMAN

NCBI Description

This intronless gene encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. Two nearly identical copies of this gene are found in a palindromic region on chromosome Y; this record represents the telomeric copy. Chromosome Y also contains a pair of closely related genes in another more telomeric palindrome as well as several related pseudogenes. [provided by RefSeq, Jul 2008]

Uniprot Description

CDY2A: May have histone acetyltransferase activity.

Protein type: Acetyltransferase; EC 2.3.1.48

Chromosomal Location of Human Ortholog: Yq11.221

Cellular Component: nucleus

Molecular Function: histone acetyltransferase activity

Biological Process: spermatogenesis; histone acetylation

Disease: Spermatogenic Failure, Y-linked, 2

Research Articles on CDY2A

Similar Products

Product Notes

The CDY2A cdy2a (Catalog #AAA6004390) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDY2A (Testis-specific Chromodomain Protein Y 2, CDY2B, CDY2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDY2A can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the CDY2A cdy2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ASTLSDTKNM EIINSTIETL APDSPFDHKK TVSGFQKLEK LDPIAADQQD TVVFKVTEGK LLRDPLSHPG AEQTGIQNKT QMHPLMSQMS GS. It is sometimes possible for the material contained within the vial of "CDY2A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.