Mouse anti-Human TRPA1 Monoclonal Antibody | anti-TRPA1 antibody

TRPA1 (Transient Receptor Potential Cation Channel Subfamily A Member 1, Ankyrin-like with Transmembrane Domains Protein 1, ANKTM1, FEPS, Transformation-sensitive Protein p120) (PE)

Cat. Num. AAA6160853

• Gene Names: TRPA1; FEPS; FEPS1; ANKTM1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TRPA1; Monoclonal Antibody; TRPA1 (Transient Receptor Potential Cation Channel Subfamily A Member 1; Ankyrin-like with Transmembrane Domains Protein 1; ANKTM1; FEPS; Transformation-sensitive Protein p120) (PE); anti-TRPA1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6G8
• Specificity: Recognizes human TRPA1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 5191

• Applicable Applications for anti-TRPA1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1033-1118 from TRPA1 (NP_015628) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.46kD).)

Product Categories/Family for anti-TRPA1 antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 1519316375
• NCBI GeneID: 8989
• NCBI Accession #: NM_007332.3
• NCBI GenBank Nucleotide #: NM_007332
• UniProt Accession #: O75762
• NCBI Official Full Name: Homo sapiens transient receptor potential cation channel subfamily A member 1 (TRPA1), mRNA
• NCBI Official Synonym Full Names: transient receptor potential cation channel subfamily A member 1
• NCBI Official Symbol: TRPA1
• NCBI Official Synonym Symbols: FEPS; FEPS1; ANKTM1
• NCBI Protein Information: transient receptor potential cation channel subfamily A member 1
• UniProt Protein Name: Transient receptor potential cation channel subfamily A member 1
• Protein Family: Transient receptor potential cation channel subfamily
• UniProt Gene Name: TRPA1
• UniProt Synonym Gene Names: ANKTM1
• UniProt Entry Name: TRPA1_HUMAN

NCBI Description

The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control. [provided by RefSeq, Jul 2008]

Uniprot Description

TRPA1: Receptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function. Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of volatile irritants, such as mustard oil, garlic and acrolein, an irritant from tears gas and vehicule exhaust fumes. Acts also as a ionotropic cannabinoid receptor by being activated by delta(9)- tetrahydrocannabinol (THC), the psychoactive component of marijuana. Not involved in menthol sensation. May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system. Belongs to the transient receptor (TC 1.A.4) family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 8q13

Cellular Component: stereocilium bundle; integral to plasma membrane; plasma membrane

Molecular Function: channel activity; calcium channel activity

Biological Process: response to drug; detection of mechanical stimulus involved in sensory perception of pain; detection of chemical stimulus involved in sensory perception of pain; response to hydrogen peroxide; response to pain; ion transport; thermoception; response to cold; transmembrane transport

Disease: Episodic Pain Syndrome, Familial, 1