Mouse anti-Human CDKN1A Monoclonal Antibody | anti-CDKN1A antibody

CDKN1A (Cyclin-dependent Kinase Inhibitor 1, CDK-interacting Protein 1, Melanoma Differentiation-associated Protein 6, MDA-6, p21, CAP20, CDKN1, CIP1, MDA6, PIC1, SDI1, WAF1) (HRP)

Cat. Num. AAA6151735

• Gene Names: CDKN1A; P21; CIP1; SDI1; WAF1; CAP20; CDKN1; MDA-6; p21CIP1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CDKN1A; Monoclonal Antibody; CDKN1A (Cyclin-dependent Kinase Inhibitor 1; CDK-interacting Protein 1; Melanoma Differentiation-associated Protein 6; MDA-6; p21; CAP20; CDKN1; CIP1; MDA6; PIC1; SDI1; WAF1) (HRP); anti-CDKN1A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2F1
• Specificity: Recognizes human CDKN1A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 164

• Applicable Applications for anti-CDKN1A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa65-164 from human CDKN1A (AAH00312.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: WERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(CDKN1A monoclonal antibody. Western Blot analysis of CDKN1A expression in human liver.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CDKN1A on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CDKN1A is ~0.1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CASP3 and CDKN1A. HeLa cells were stained with CASP3 rabbit purified polyclonal 1:1200 and CDKN1A mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-CDKN1A antibody

CDKN1A is a potent cyclin-dependent kinase inhibitor. It binds to and inhibits the activity of cyclin-CDK2 or -CDK4 complexes, and thus functions as a regulator of cell cycle progression at G1. Expression is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen (PCNA), a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of CDK2, and may be instrumental in the execution of apoptosis following caspase activation.

Product Categories/Family for anti-CDKN1A antibody

Antibodies; Protein Kinases

References

1. Phospho-?GNp63? is a key regulator of the cisplatin-induced microRNAome in cancer cells. Huang Y, Chuang A, Hao H, Talbot C, Sen T, Trink B, Sidransky D, Ratovitski E.Cell Death Differ. 2011 Jan 28.

NCBI and Uniprot Product Information

• NCBI GI #: 12653093
• NCBI GeneID: 1026
• NCBI Accession #: AAH00312.1
• NCBI GenBank Nucleotide #: NM_000389
• NCBI Official Full Name: Cyclin-dependent kinase inhibitor 1A (p21, Cip1)
• NCBI Official Synonym Full Names: cyclin dependent kinase inhibitor 1A
• NCBI Official Symbol: CDKN1A
• NCBI Official Synonym Symbols: P21; CIP1; SDI1; WAF1; CAP20; CDKN1; MDA-6; p21CIP1
• NCBI Protein Information: cyclin-dependent kinase inhibitor 1

NCBI Description

This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-cyclin-dependent kinase2 or -cyclin-dependent kinase4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen, a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of cyclin-dependent kinase2, and may be instrumental in the execution of apoptosis following caspase activation. Mice that lack this gene have the ability to regenerate damaged or missing tissue. Multiple alternatively spliced variants have been found for this gene. [provided by RefSeq, Sep 2015]