Mouse anti-Human CDKL2 Monoclonal Antibody | anti-CDKL2 antibody

CDKL2 (Cyclin-dependent Kinase-like 2, Protein Kinase p56 KKIAMRE, Serine/Threonine-protein Kinase KKIAMRE) (Biotin)

Cat. Num. AAA6141125

• Gene Names: CDKL2; P56; KKIAMRE
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CDKL2; Monoclonal Antibody; CDKL2 (Cyclin-dependent Kinase-like 2; Protein Kinase p56 KKIAMRE; Serine/Threonine-protein Kinase KKIAMRE) (Biotin); anti-CDKL2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1F6
• Specificity: Recognizes human CDKL2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CDKL2 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa394-493 from CDKL2 (NP_003939) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LKDCSNVSVDHTRNPSVAIPPLTHNLSAVAPSINSGMGTETIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLVSGPPLSDDSGADLPQMEHQH
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CDKL2 on HeLa cell. [antibody concentration 10ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CDKL2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 0.7ug/ml])

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Product Categories/Family for anti-CDKL2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4505569
• NCBI GeneID: 8999
• NCBI Accession #: NP_003939
• NCBI GenBank Nucleotide #: NM_003948
• UniProt Accession #: Q92772
• Molecular Weight: 54kDa
• NCBI Official Full Name: cyclin-dependent kinase-like 2 isoform 1
• NCBI Official Synonym Full Names: cyclin dependent kinase like 2
• NCBI Official Symbol: CDKL2
• NCBI Official Synonym Symbols: P56; KKIAMRE
• NCBI Protein Information: cyclin-dependent kinase-like 2
• UniProt Protein Name: Cyclin-dependent kinase-like 2
• Protein Family: Cyclin-dependent kinase
• UniProt Gene Name: CDKL2
• UniProt Entry Name: CDKL2_HUMAN

NCBI Description

This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus. [provided by RefSeq, Jul 2008]

Uniprot Description

CDKL2: a protein kinase of the CDKL family. Accumulates primarily in the cytoplasm, with a lower level in the nucleus.

Protein type: Protein kinase, CMGC; Kinase, protein; Cell cycle regulation; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.22; CMGC group; CDKL family

Chromosomal Location of Human Ortholog: 4q21.1

Cellular Component: nucleoplasm; centrosome; cytoplasm; nucleus

Molecular Function: cyclin-dependent protein kinase activity; ATP binding; protein kinase activity

Biological Process: regulation of cell cycle; signal transduction; protein amino acid phosphorylation; sex differentiation