Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CDKL1 Monoclonal Antibody | anti-CDKL1 antibody

CDKL1 (Cyclin-dependent Kinase-like 1 (CDC2-related Kinase), P42, KKIALRE) (MaxLight 750)

Gene Names
CDKL1; P42; KKIALRE
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
CDKL1; Monoclonal Antibody; CDKL1 (Cyclin-dependent Kinase-like 1 (CDC2-related Kinase); P42; KKIALRE) (MaxLight 750); anti-CDKL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G8
Specificity
Recognizes human CDKL1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-CDKL1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa259-358 from human CDKL1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CDKL1 antibody
This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the nucleus. Alternative splice variants encoding different protein isoforms have been described, but their full-length nature has not been determined.
Product Categories/Family for anti-CDKL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42 kDa
NCBI Official Full Name
cyclin-dependent kinase-like 1 isoform 1
NCBI Official Synonym Full Names
cyclin dependent kinase like 1
NCBI Official Symbol
CDKL1
NCBI Official Synonym Symbols
P42; KKIALRE
NCBI Protein Information
cyclin-dependent kinase-like 1
UniProt Protein Name
Cyclin-dependent kinase-like 1
Protein Family
UniProt Gene Name
CDKL1
UniProt Entry Name
CDKL1_HUMAN

NCBI Description

This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]

Uniprot Description

CDKL1: a protein kinase of the CDKL family. Accumulates primarily in the nucleus.

Protein type: Kinase, protein; EC 2.7.11.22; Protein kinase, Ser/Thr (non-receptor); Protein kinase, CMGC; Cell cycle regulation; CMGC group; CDKL family

Chromosomal Location of Human Ortholog: 14q21.3

Cellular Component: cytoplasm; nucleus

Molecular Function: cyclin-dependent protein kinase activity; ATP binding

Biological Process: regulation of cell cycle; heart development; protein amino acid phosphorylation

Research Articles on CDKL1

Similar Products

Product Notes

The CDKL1 cdkl1 (Catalog #AAA6236799) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDKL1 (Cyclin-dependent Kinase-like 1 (CDC2-related Kinase), P42, KKIALRE) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDKL1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDKL1 cdkl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDKL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.