Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit is ~0.03ng/ml using MBS6013636 as a capture antibody.)

Mouse anti-Human CDHR3 Monoclonal Antibody | anti-CDHR3 antibody

CDHR3 (Cadherin-related Family Member 3, Cadherin-like Protein 28, CDH28, FLJ23834, FLJ43271, FLJ44366, MGC133292, MGC133293) (Biotin)

Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDHR3; Monoclonal Antibody; CDHR3 (Cadherin-related Family Member 3; Cadherin-like Protein 28; CDH28; FLJ23834; FLJ43271; FLJ44366; MGC133292; MGC133293) (Biotin); anti-CDHR3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
8E8
Specificity
Recognizes human CDHR3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
885
Applicable Applications for anti-CDHR3 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa776-885 from human CDHR3 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IFDGEAIDPVTGETYEFNSKTGARKWKDPLTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit is ~0.03ng/ml using MBS6013636 as a capture antibody.)

Testing Data (Detection limit is ~0.03ng/ml using MBS6013636 as a capture antibody.)

Western Blot (WB)

(Western Blot detection against immunogen using MBS6013636 (38.21kD).)

Western Blot (WB) (Western Blot detection against immunogen using MBS6013636 (38.21kD).)

Immunofluorescence (IF)

(Immunofluorescence analysis of HeLa cells using MBS6013636 (10ug/ml).)

Immunofluorescence (IF) (Immunofluorescence analysis of HeLa cells using MBS6013636 (10ug/ml).)
Related Product Information for anti-CDHR3 antibody
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
Product Categories/Family for anti-CDHR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
cadherin-related family member 3 isoform 1
UniProt Protein Name
Cadherin-related family member 3
Protein Family
UniProt Gene Name
CDHR3
UniProt Synonym Gene Names
CDH28

Uniprot Description

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.(Microbial infection) Acts as a receptor for rhinovirus C.

Similar Products

Product Notes

The CDHR3 cdhr3 (Catalog #AAA6141927) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDHR3 (Cadherin-related Family Member 3, Cadherin-like Protein 28, CDH28, FLJ23834, FLJ43271, FLJ44366, MGC133292, MGC133293) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDHR3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDHR3 cdhr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDHR3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.