Western Blot (WB)
(Western Blot detection against Immunogen (37.77kD).)
Mouse anti-Human CDC42BPG Monoclonal Antibody | anti-CDC42BPG antibody
CDC42BPG (Serine/Threonine-protein Kinase MRCK gamma, CDC42-binding Protein Kinase gamma, DMPK-like gamma, Myotonic Dystrophy Kinase-related CDC42-binding Kinase gamma, MRCK gamma, MRCKG, Myotonic Dystrophy Protein Kinase-like gamma, Myotonic Dystrophy Pr
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDC42BPG; Monoclonal Antibody; CDC42BPG (Serine/Threonine-protein Kinase MRCK gamma; CDC42-binding Protein Kinase gamma; DMPK-like gamma; Myotonic Dystrophy Kinase-related CDC42-binding Kinase gamma; MRCK gamma; MRCKG; Myotonic Dystrophy Protein Kinase-like gamma; Myotonic Dystrophy Pr; anti-CDC42BPG antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C3
Specificity
Recognizes human CDC42BPG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1551
Applicable Applications for anti-CDC42BPG antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1423-1529 from human CDC42BPG (NP_059995) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RREMLKDPFVRSKLISPPTNFNHLVHVGPANGRPGARDKSPAPEEKGRVARGSGPQRPHSFSEALRRPASMGSEGLGGDADPMKRKPWTSLSSESVSCPQGSLSPA
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.77kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.77kD).)
Testing Data
(Detection limit for recombinant GST tagged CDC42BPG is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged CDC42BPG is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-CDC42BPG antibody
May act as a downstream effector of CDC42 in cytoskeletal reorganization. Contributes to the actomyosin contractility required for cell invasion, through the regulation of MYPT1 and thus MLC2 phosphorylation.
Product Categories/Family for anti-CDC42BPG antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
serine/threonine-protein kinase MRCK gamma
UniProt Protein Name
Serine/threonine-protein kinase MRCK gamma
Protein Family
UniProt Gene Name
CDC42BPG
UniProt Synonym Gene Names
DMPK2; MRCK gamma; MRCKG; Myotonic dystrophy protein kinase-like gamma
UniProt Entry Name
MRCKG_HUMAN
Similar Products
Product Notes
The CDC42BPG cdc42bpg (Catalog #AAA6135803) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDC42BPG (Serine/Threonine-protein Kinase MRCK gamma, CDC42-binding Protein Kinase gamma, DMPK-like gamma, Myotonic Dystrophy Kinase-related CDC42-binding Kinase gamma, MRCK gamma, MRCKG, Myotonic Dystrophy Protein Kinase-like gamma, Myotonic Dystrophy Pr reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDC42BPG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDC42BPG cdc42bpg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDC42BPG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
